Recombinant Pseudomonas syringae pv. tomato Disulfide bond formation protein B (dsbB)

What is Pseudomonas syringae pv. tomato DC3000 and why is it a significant model organism?

Pseudomonas syringae pv. tomato strain DC3000 (PtoDC3000) is one of the most intensively studied bacterial plant pathogens in contemporary research . This gram-negative bacterial pathogen has been used as a model system for understanding plant-bacterial interactions since the early 1980s . The significance of PtoDC3000 as a model organism stems from its ability to infect not only its natural host tomato but also the model plant Arabidopsis thaliana in laboratory conditions, a discovery reported in 1991 that catalyzed extensive research efforts .

This strain carries a large repertoire of potential virulence factors, including proteinaceous effectors secreted through the type III secretion system and a polyketide phytotoxin called coronatine, which structurally mimics the plant hormone jasmonate (JA) . PtoDC3000 has a relatively wide host range compared to other P. syringae pv. tomato isolates, as it can infect plants from both Brassicaceae and Solanaceae families, including tomato, Arabidopsis thaliana, and cauliflower . This makes it a particularly useful model for studying host-pathogen interactions across different plant species.

The extensive genetic and genomic resources available for DC3000 have enabled highly productive research centered on the mechanisms of plant host susceptibility/resistance and pathogen virulence factors . Studies with PtoDC3000 have provided several conceptual advances in understanding how bacterial pathogens employ type III effectors to suppress plant immune responses and promote disease susceptibility .

What is the structure and function of dsbB protein in Pseudomonas syringae pv. tomato?

The disulfide bond formation protein B (dsbB) in Pseudomonas syringae pv. tomato DC3000 is identified by the UniProt accession number Q887H2 . This protein functions as a disulfide oxidoreductase, which is typically involved in the formation of disulfide bonds in bacterial proteins. The full amino acid sequence of dsbB consists of 169 amino acids:

MSNDTFYLKREKRFLVLLGIICLSLIGGALYMQIALGEAPCPLCILQRYALLFIAIFAFI
GAAMNGRRGVTVFEALVTLSALCGIAAAGRHAWILAHPSDSCGIDILQPIVDGLPLATLF
PTGFQVSGFCTTPYPPVLGLSLAQWALTAFVLTAILVPACIIRNRRKPY

The dsbB protein contains cysteine residues that are critical for its catalytic activity. In bacterial systems, dsbB typically works in conjunction with dsbA to form a pathway that catalyzes disulfide bond formation in proteins in the periplasmic space. The dsbB protein is located in the inner membrane and functions to reoxidize dsbA after it has transferred its disulfide bond to substrate proteins. This system is essential for the proper folding of many secreted bacterial proteins, including various virulence factors.

In the specific context of P. syringae pv. tomato, the dsbB protein likely plays an important role in the correct folding of proteins involved in virulence and pathogenicity, potentially including components of the type III secretion system that are critical for bacterial infection of plant hosts.

How is recombinant dsbB protein typically expressed and purified for research use?

The expression and purification of recombinant dsbB protein from Pseudomonas syringae pv. tomato involves several methodological considerations due to its membrane-associated nature. Based on standard recombinant protein techniques and the information provided, the following methodology is typically employed:

Expression systems: The dsbB gene (PSPTO_1324) from P. syringae pv. tomato DC3000 is cloned into an appropriate expression vector, often with a tag (His-tag, GST, or other affinity tags) to facilitate purification . The expression region typically encompasses the full-length protein (amino acids 1-169) . The choice of expression system is critical, with E. coli being the most common host for recombinant bacterial protein production.

Membrane protein considerations: Since dsbB is a membrane protein, expression conditions must be optimized to prevent protein aggregation and ensure proper membrane insertion. This may involve lower induction temperatures (16-25°C), specialized E. coli strains, and the use of detergents during purification.

Purification protocol: After cell lysis, membrane fractions are typically isolated by ultracentrifugation. The membrane proteins are then solubilized using detergents compatible with downstream applications. Affinity chromatography (based on the chosen tag) is used for initial purification, followed by additional purification steps such as ion exchange chromatography or size exclusion chromatography to achieve high purity.

Storage considerations: Purified recombinant dsbB protein is typically stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage . Repeated freezing and thawing should be avoided to maintain protein integrity, and working aliquots can be stored at 4°C for up to one week .

Quality control: The purified protein is assessed for purity by SDS-PAGE and functional activity through appropriate enzymatic assays that measure disulfide bond formation capability.

What experimental approaches can be used to study the role of dsbB in P. syringae virulence?

Investigating the role of dsbB in P. syringae virulence requires a multi-faceted experimental approach combining genetic manipulation, biochemical analysis, and plant infection studies:

Gene deletion and complementation: Creating a dsbB knockout mutant in P. syringae pv. tomato DC3000 using methods similar to those described for creating pvdI mutants . This involves constructing a deletion vector, performing triparental mating, selecting for integration events, and confirming gene deletion by PCR. Complementation with the wild-type dsbB gene would confirm that any observed phenotypes are specifically due to the absence of dsbB.

Virulence assays: Testing the pathogenicity of dsbB mutants in comparison to wild-type bacteria using both infiltration and dipping methods on host plants like tomato (Solanum lycopersicon) or Arabidopsis thaliana . Bacterial growth in planta can be quantified over time to determine if dsbB contributes to bacterial multiplication in host tissues. Symptom development should be monitored and quantified using appropriate disease scoring systems.

Type III secretion system (T3SS) functionality: Given the importance of T3SS in P. syringae virulence, the impact of dsbB mutation on the expression and functionality of this system should be assessed. This can include monitoring the expression of T3SS component genes and effector proteins like AvrPto using transcriptional reporters or immunoblotting techniques . Hypersensitive response (HR) assays in non-host or resistant plants can further evaluate T3SS functionality in dsbB mutants.

Protein oxidation state analysis: Examining the oxidation states of periplasmic proteins in wild-type versus dsbB mutant strains to identify specific substrates whose folding depends on dsbB-mediated disulfide bond formation. This can be achieved using techniques such as diagonal SDS-PAGE or mass spectrometry-based approaches that can detect differences in cysteine oxidation states.

Environmental stress response: Testing the sensitivity of dsbB mutants to various environmental stresses encountered during plant infection (oxidative stress, pH fluctuations, antimicrobial peptides) to determine if dsbB contributes to bacterial survival under these conditions.

How does dsbB potentially interact with the type III secretion system in P. syringae?

The type III secretion system (T3SS) is a critical virulence determinant in Pseudomonas syringae pv. tomato DC3000 that allows the bacterium to deliver effector proteins into plant cells to suppress immune responses and promote disease . The potential interaction between dsbB and the T3SS can be investigated from several perspectives:

Disulfide bond formation in T3SS components: Many components of the T3SS must be correctly folded and assembled to form a functional secretion apparatus. If any of these components require disulfide bonds for proper folding or function, dsbB would play an indirect but essential role in T3SS functionality. Researchers can identify T3SS proteins containing cysteine residues and determine if their folding is compromised in dsbB mutants.

Effector protein maturation: T3SS effector proteins like AvrPto may require proper folding involving disulfide bonds before secretion. The expression, stability, and secretion of these effectors can be compared between wild-type and dsbB mutant strains using immunoblotting techniques with specific antibodies against effector proteins.

Regulatory connections: The GacS/GacA two-component system is essential for virulence in P. syringae pv. tomato DC3000 and regulates the expression of T3SS effectors . Experimental approaches to investigate potential regulatory links between dsbB and the GacS/GacA system could include transcriptomic analysis comparing gene expression patterns in wild-type, dsbB mutant, and gacA mutant strains. Additionally, chromatin immunoprecipitation (ChIP) assays could determine if GacA directly regulates dsbB expression.

Functional assays for T3SS in dsbB mutants: The functionality of the T3SS in dsbB mutants can be assessed by monitoring the plant hypersensitive response (HR) triggered by DC3000 in resistant plant varieties . A reduced or delayed HR would suggest compromised T3SS function. Additionally, translocation assays using reporter-fusion effector proteins can directly measure the ability of dsbB mutants to deliver effectors into plant cells.

Protein-protein interaction studies: Co-immunoprecipitation, bacterial two-hybrid systems, or proximity labeling approaches can be used to identify direct interactions between dsbB and T3SS components or regulatory proteins.

How can researchers investigate the evolutionary significance of dsbB in P. syringae adaptation to different hosts?

The evolutionary significance of dsbB in P. syringae adaptation to different hosts can be investigated through several complementary approaches:

Recombination analysis: Investigating whether recombination has played a role in dsbB evolution, similar to studies showing that recombination has contributed significantly to variation between P. syringae isolates . Population genetic tests and detection of recombination breakpoints within the dsbB gene or flanking regions would provide insights into how horizontal gene transfer might have influenced dsbB evolution.

Functional complementation experiments: Creating chimeric dsbB proteins by swapping domains between dsbB from P. syringae strains with different host ranges to determine which regions are important for host-specific functions. Expressing these chimeric proteins in dsbB mutants and testing their ability to restore virulence on different host plants would link sequence differences to functional adaptation.

Correlation with effector repertoires: Analyzing the co-evolution of dsbB with type III secreted effector repertoires across P. syringae strains. Since recombination may play an important role in the reassortment of T3S effectors between strains , understanding whether dsbB co-evolves with specific effectors could provide insights into its role in host adaptation.

Host range studies: Testing dsbB mutants and complemented strains on a range of potential host plants to determine if dsbB contributes to host range determination. This would be particularly interesting given that PtoDC3000 has an unusually wide host range compared to other tomato isolates .

What are the technical challenges in studying membrane proteins like dsbB?

Studying membrane proteins like dsbB presents several technical challenges that require specialized approaches:

Expression and purification difficulties: Membrane proteins often express poorly in heterologous systems and can form inclusion bodies. To overcome this, researchers can optimize expression conditions (temperature, inducer concentration, duration) and use specialized E. coli strains designed for membrane protein expression. Fusion partners like MBP (maltose-binding protein) can enhance solubility, while the addition of specific detergents during purification helps maintain protein structure and function.

Structural analysis limitations: Traditional structural biology techniques like X-ray crystallography are challenging with membrane proteins due to difficulties in forming well-ordered crystals. Alternative approaches include cryo-electron microscopy (cryo-EM), which has revolutionized membrane protein structural biology, or nuclear magnetic resonance (NMR) spectroscopy for smaller membrane proteins or domains. Computational modeling based on homologous proteins can also provide structural insights when experimental data is limited.

Functional assays in native membrane environments: Assessing the activity of purified dsbB requires reconstitution into a membrane-like environment. Researchers can use proteoliposomes, nanodiscs, or detergent micelles to create an environment that mimics the native membrane. Activity assays typically monitor the ability of dsbB to oxidize its partner protein (dsbA) using fluorescent or colorimetric methods that detect changes in the redox state.

Protein-protein interaction detection: Identifying interaction partners of membrane proteins requires specialized techniques. Approaches like in vivo photo-crosslinking, proximity-dependent biotin identification (BioID), or split-ubiquitin yeast two-hybrid systems are adapted for membrane protein interactions. For dsbB specifically, identifying its substrates can involve trapping techniques where mutated dsbB forms stable mixed disulfides with target proteins that can then be isolated and identified.

In vivo localization and dynamics: Visualizing membrane proteins in their native context requires careful fusion protein design to avoid disrupting membrane insertion. Super-resolution microscopy techniques can help overcome the diffraction limit to study the precise localization and clustering of dsbB in bacterial membranes.

How can researchers resolve discrepancies in experimental data regarding dsbB function?

When faced with contradictory results regarding dsbB function in Pseudomonas syringae pv. tomato, researchers can employ several strategies to resolve discrepancies:

Standardization of experimental conditions: Different growth conditions, media compositions, or plant cultivation methods can significantly impact results, especially for virulence-related phenotypes. Researchers should establish standardized protocols for bacterial cultivation, plant infection assays, and protein functional studies. For example, when testing pathogenicity, both vacuum infiltration and dipping methods should be employed as they assess different aspects of the infection process .

Genetic background verification: Unexpected results may stem from secondary mutations or strain variations. Whole-genome sequencing of mutant strains can identify unintended mutations. Creating multiple independent mutants using different methodologies (clean deletion vs. insertion) can confirm that observed phenotypes are specifically due to dsbB disruption. Complementation studies are essential to verify that phenotypes can be restored by reintroducing the wild-type gene.

Quantitative approaches: Replacing qualitative assessments with quantitative measurements reduces subjectivity and allows statistical analysis. For example, bacterial growth in planta should be measured by colony-forming unit counts at multiple time points rather than visual symptom assessment alone. Similarly, protein activity should be quantified using sensitive enzymatic assays rather than end-point determinations.

Consideration of environmental variables: The importance of dsbB may vary with environmental conditions. For instance, iron availability significantly affects P. syringae virulence mechanisms , and similar environmental factors might influence dsbB-dependent phenotypes. Testing under various conditions (temperature, humidity, light cycles, nutrient availability) can reveal context-dependent functions.

Multi-technique validation: Important findings should be verified using complementary techniques. For example, protein-protein interactions identified by co-immunoprecipitation should be confirmed by alternative methods like bacterial two-hybrid assays or FRET (Förster resonance energy transfer). Similarly, transcriptional effects observed in microarray studies should be validated by RT-qPCR.

What novel methodologies are emerging for studying disulfide bond formation in bacterial pathogens?

Several cutting-edge methodologies are transforming our understanding of disulfide bond formation in bacterial pathogens like Pseudomonas syringae:

Redox proteomics: Advanced mass spectrometry-based techniques can now identify and quantify the redox state of individual cysteine residues proteome-wide. Techniques like OxICAT (oxidative isotope-coded affinity tag) or iodoTMT (iodoacetyl tandem mass tag) labeling allow researchers to compare the oxidation states of proteins between wild-type and dsbB mutant strains, identifying the complete substrate range of the disulfide bond formation pathway in vivo.

CRISPR interference (CRISPRi) for conditional depletion: Rather than creating complete gene deletions, CRISPRi allows for tunable repression of dsbB expression, enabling the study of partial loss-of-function phenotypes that might better mimic the effects of potential inhibitors. This approach is particularly valuable for essential genes or those with pleiotropic effects.

In vivo disulfide bond monitoring: Genetically encoded fluorescent redox sensors can be used to monitor disulfide bond formation in real-time in living bacteria. These sensors, based on redox-sensitive fluorescent proteins, can be targeted to different cellular compartments to measure redox changes during infection processes or in response to environmental stresses.

Single-molecule tracking: Advanced microscopy techniques allow tracking of individual dsbB molecules in bacterial membranes, providing insights into their diffusion, clustering, and interactions with partner proteins. These approaches can reveal the spatial organization of the disulfide bond formation machinery during infection.

Targeted protein degradation: Technologies like the degron system allow for rapid post-translational depletion of dsbB protein, enabling temporal studies of how quickly disulfide bond formation defects manifest in various phenotypes. This approach helps distinguish direct from indirect effects of dsbB disruption.

Microfluidics combined with time-lapse microscopy: These techniques allow researchers to monitor bacterial responses to changing environmental conditions at the single-cell level, providing insights into how dsbB function might vary across bacterial populations and in response to host-derived signals or antimicrobial compounds.

How can dsbB be targeted for developing new strategies to control bacterial plant diseases?

Targeting dsbB presents several promising avenues for developing novel control strategies against Pseudomonas syringae and other bacterial plant pathogens:

Small molecule inhibitors: Designing specific small molecule inhibitors of dsbB enzymatic activity could disrupt disulfide bond formation in key virulence factors. A similar approach has been explored with the GacS/GacA system in P. syringae, where an extract from Bacillus sp. BR3 was found to inhibit this important virulence-regulating two-component system . High-throughput screening assays can identify compounds that specifically inhibit dsbB oxidoreductase activity without affecting plant enzymes.

Peptide-based inhibitors: Developing peptides that mimic dsbB's interaction surfaces with its partner proteins could competitively inhibit its function. These peptides could be applied as foliar sprays or expressed in transgenic plants to provide protection against P. syringae infection.

RNA silencing approaches: Short interfering RNAs (siRNAs) targeting dsbB mRNA could be delivered to bacteria through specialized nanoparticles or expressed in transgenic plants. When bacteria attempt to infect plant tissues, they would encounter these siRNAs, leading to degradation of dsbB mRNA and reduced protein expression.

Structure-based drug design: Using structural information about dsbB to rationally design inhibitors that bind to catalytic sites or disrupt essential protein-protein interactions. This approach requires detailed structural characterization of dsbB, potentially using cryo-electron microscopy or computational modeling based on homologous proteins.

Combination approaches: Targeting dsbB in combination with other virulence factors might provide more effective control. For example, combining dsbB inhibitors with compounds that target the GacS/GacA system could synergistically reduce bacterial virulence through different but complementary mechanisms.

What methodologies are most effective for studying the in vivo activity of dsbB during plant infection?

Understanding the in vivo activity of dsbB during plant infection requires specialized methodologies that can provide insights into protein function in the complex environment of the plant-pathogen interface:

Redox-sensitive fluorescent reporters: Genetically engineered P. syringae strains carrying redox-sensitive fluorescent proteins (like roGFP) fused to periplasmic proteins can serve as biosensors to monitor disulfide bond formation activity during infection. Confocal microscopy of infected plant tissues can then visualize changes in the oxidation state of these reporters in wild-type versus dsbB mutant bacteria.

Temporal transcriptomics and proteomics: RNA-seq and quantitative proteomics analysis of bacteria recovered from infected plants at different time points can reveal how dsbB expression and the oxidation state of its substrate proteins change during the infection process. Comparing these profiles between compatible (susceptible) and incompatible (resistant) plant-pathogen interactions can further illuminate the role of dsbB in virulence.

In planta bacterial two-hybrid systems: Modified bacterial two-hybrid approaches that function in the context of plant infection can identify interaction partners of dsbB that are specifically relevant during pathogenesis. These systems can be designed to only report interactions that occur within plant tissues under infection conditions.

BONCAT (Bio-Orthogonal Non-Canonical Amino Acid Tagging): This technique allows selective labeling and identification of proteins synthesized during specific time windows of infection. By providing non-canonical amino acids to bacteria during plant infection and later performing click chemistry to isolate the labeled proteins, researchers can determine which dsbB-dependent proteins are actively synthesized during different stages of pathogenesis.

Single-cell analysis of bacterial populations in planta: Laser capture microdissection combined with single-cell RNA-seq can analyze the heterogeneity in dsbB expression and activity across bacterial populations within infected plant tissues. This approach can reveal whether subpopulations of bacteria differentially regulate disulfide bond formation during infection.

What are the most promising future research directions for dsbB in plant pathogenic bacteria?

The study of dsbB in Pseudomonas syringae pv. tomato and other plant pathogenic bacteria presents several exciting future research directions:

Comprehensive substrate identification: While dsbB is known to be involved in disulfide bond formation, a systematic identification of all its substrate proteins in P. syringae would provide crucial insights into its role in virulence. Advanced proteomic approaches combining redox proteomics with comparative analyses of dsbB mutants could reveal the complete network of proteins depending on dsbB for proper folding and function.

Host-specific adaptation: Investigating whether dsbB function or its substrate specificity has evolved differently across P. syringae pathovars that infect different plant hosts could reveal its role in host adaptation. This exploration aligns with findings that recombination has contributed significantly to variation between P. syringae isolates and may play an important role in the reassortment of virulence factors between strains .

Integration with other virulence regulatory networks: Exploring the potential connections between dsbB function and established virulence regulatory systems like the GacS/GacA two-component system could reveal how disulfide bond formation is coordinated with other aspects of the virulence program. This would provide a more holistic understanding of how P. syringae regulates its pathogenicity.

Structural biology of plant pathogen-specific features: Determining whether dsbB from plant pathogenic bacteria has structural or functional features distinct from those of animal pathogens or non-pathogens could identify potential targets for pathogen-specific inhibitors. Advanced structural biology techniques like cryo-EM could reveal unique aspects of dsbB structure in plant pathogens.

Environmental adaptation role: Investigating how dsbB contributes to bacterial survival under various environmental stresses encountered during the plant infection cycle (including transitions between epiphytic and endophytic lifestyles) would provide insights into its role beyond direct virulence function.

How might technical advances improve our understanding of dsbB function in the future?

Emerging technologies and methodological advances promise to transform our understanding of dsbB function in Pseudomonas syringae:

Single-molecule techniques: Advanced microscopy methods that track individual protein molecules in living cells will allow researchers to visualize dsbB dynamics, localization, and interactions in unprecedented detail. These approaches can reveal how dsbB behaves during different stages of infection and in response to host defense responses.

CRISPR-based technologies: CRISPR systems adapted for bacterial pathogens will enable precise genome editing to create subtle mutations in dsbB and related genes, facilitating structure-function studies that were previously challenging. CRISPRi approaches also allow for conditional and graduated repression of gene expression, enabling the study of essential genes like dsbB under partial depletion conditions.

Microfluidics and lab-on-a-chip systems: These technologies can recreate microenvironments mimicking plant apoplastic spaces where P. syringae grows during infection. Combined with time-lapse imaging, they can reveal how dsbB function responds to changing conditions at the plant-pathogen interface with high temporal resolution.

Artificial intelligence for protein function prediction: Machine learning approaches trained on large datasets of protein structures and functions are becoming increasingly powerful at predicting protein interactions and functional networks. These tools could identify previously unrecognized connections between dsbB and other cellular processes in P. syringae.

Multi-omics integration: The integration of transcriptomics, proteomics, metabolomics, and structural biology data through advanced computational approaches will provide a systems-level understanding of dsbB function within the broader context of bacterial physiology and pathogenesis. This holistic view is essential for understanding how targeting dsbB might affect bacterial fitness and virulence.