Recombinant Pseudomonas syringae pv. tomato Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Overview of MsbA in Gram-Negative Bacteria

MsbA is an ATP-binding cassette (ABC) transporter critical for lipid A and lipopolysaccharide (LPS) transport in Gram-negative bacteria. It functions as a homodimer, utilizing ATP hydrolysis to flip lipid A from the cytoplasmic to the periplasmic leaflet of the inner membrane, a process essential for outer membrane biogenesis and bacterial viability . Structural studies reveal MsbA’s architecture comprises:

  • Two transmembrane domains (TMDs): Each with six helices forming a lipid-translocating cavity .

  • Two nucleotide-binding domains (NBDs): Responsible for ATP binding and hydrolysis .
    MsbA’s conformational changes between inward- and outward-facing states enable substrate transport, as observed in Salmonella typhimurium and Escherichia coli homologs .

Table 2: Key Functional Residues in MsbA

ResidueRole in Lipid A BindingMutant Phenotype
R188Exterior site coordinationReduced ATPase activity, impaired binding
R238Interior site stabilizationWeakened lipid A affinity
K299Polar headgroup interactionMinimal impact on lipid transport

Functional Role in Bacterial Pathogenicity

Though Pseudomonas syringae pv. tomato MsbA-specific data are sparse, its homologs in P. fluorescens and E. coli highlight conserved roles:

  • Lipid A Transport: Essential for LPS assembly, a key virulence factor in Gram-negative pathogens .

  • Drug Efflux: Binds amphipathic compounds (e.g., Hoechst 33342) with micromolar affinity, suggesting a secondary role in multidrug resistance .

  • Plant Infection: P. syringae pv. tomato upregulates GABA catabolism during apoplast colonization, a process potentially linked to MsbA-mediated nutrient sensing .

Research Gaps and Future Directions

  • Species-Specific Studies: Structural and functional characterization of P. syringae pv. tomato MsbA remains unexplored.

  • Substrate Specificity: Whether this isoform transports phospholipids (e.g., phosphatidylethanolamine) akin to E. coli MsbA requires validation .

  • Therapeutic Targeting: MsbA inhibitors could disrupt LPS biogenesis, offering novel antibiotic strategies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
msbA; PSPTO_4984; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-600
Protein Length
full length protein
Species
Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Target Names
msbA
Target Protein Sequence
MTTPESSATSSVKIYFRLLSYVRPYVGIFLLSILGFVIFASTQPMLAGILKYFVDGLSNP EAVLFPNVPYLRELQLLQAVPLLIVLIAAWQGLGSFLGNYFLAKVSLGLVHDLRVELFNK LLVLPNRYFDTTNSGHLISRITFNVTMVTGAATDAIKVVIREGLTVVFLFIYLLMMNWKL TLVMLAILPLIAVMVSSASKKFRKQSKKIQVAMGDVTHVASETIQGYRVVRSFGGEAYEQ NRFAEASDSNTRKQLRMTKTGAIYTPMLQLVIYSAMAVLMFLVLFLRGDATAGDLVAYIT AAGLLPKPIRQLSEVSSTIQKGVAGAESIFEQLDVEEEVDTGTIELDRVSGHLEVKNLSF FYPQTERQVLNDISFSAAPGQMIALVGRSGSGKSTLANLIPRFYGHEMGNILLDGVEIND YRLRNLRKHIAQVNQNVTLFNDSIANNIAYGDLAGAPRADIEAAAADAYAKEFIDQLPQG FDTQVGENGVLLSGGQRQRLAIARALLKNAPLLILDEATSALDTESERHIQAALDHVMKG RTTLVIAHRLSTIEKADMILVMDAGKIVERGTHTELLAQNGYYARLHAMGLDEPAPAGAV
Uniprot No.

Target Background

Function
This protein is involved in lipopolysaccharide (LPS) biosynthesis. It translocates lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of MsbA in Pseudomonas syringae pv. tomato?

MsbA in P. syringae pv. tomato, similar to its homologs in other gram-negative bacteria, functions as an ATP-binding cassette (ABC) transporter required for the export of lipopolysaccharides (LPS) to the outer membrane. Specifically, it mediates the transport of the lipid A core moiety from the cytoplasmic membrane to the outer membrane, where this lipid functions as the hydrophobic anchor of LPS . This transport mechanism is essential for cell viability, as lipid A forms the critical structural component of the outer membrane. Based on homology with other bacterial species, P. syringae MsbA likely participates in maintaining membrane integrity and potentially contributes to antibiotic resistance through multidrug transport capabilities .

How does MsbA function differ between Pseudomonas syringae and other bacterial species?

While the core function of MsbA as an LPS transporter is conserved across gram-negative bacteria, several important differences may exist in P. syringae pv. tomato compared to well-characterized homologs like those in E. coli. These differences likely reflect evolutionary adaptations to specific environmental niches and host interactions. Unlike E. coli MsbA, which has been extensively characterized structurally and functionally, P. syringae MsbA may exhibit altered substrate specificity related to the specific composition of its LPS, potentially influencing virulence and host-pathogen interactions .

The evolutionary context of P. syringae as a plant pathogen suggests its MsbA may have adapted to cope with plant defense compounds. Additionally, the high genetic diversity observed across the P. syringae species complex, with distinct phylogroups showing different levels of host specificity, indicates that MsbA function may vary across pathovars in ways that contribute to host adaptation and pathogenicity .

What is the relationship between MsbA function and P. syringae virulence?

MsbA's critical role in LPS transport positions it as a key contributor to bacterial virulence through several potential mechanisms:

  • Membrane integrity: Proper LPS transport ensures outer membrane stability, protecting the bacterium from host defense compounds.

  • Host immune evasion: LPS structural modifications that may be dependent on MsbA transport can influence recognition by plant pattern recognition receptors.

  • Antibiotic/antimicrobial compound resistance: Similar to its homologs in other bacteria, P. syringae MsbA likely contributes to efflux of plant-derived antimicrobial compounds .

Experimental evidence from seed infection assays with various P. syringae isolates demonstrates significant differences in virulence between strains, potentially correlating with differences in membrane components and transport systems . The complex relationship between phylogenetic groups and host specificity observed in P. syringae suggests that variations in membrane transport systems like MsbA may contribute to these adaptation patterns, though direct experimental evidence specifically linking MsbA variants to virulence differences in P. syringae pv. tomato would require targeted studies .

What expression systems are most effective for producing recombinant P. syringae MsbA protein?

For the recombinant expression of P. syringae pv. tomato MsbA, several expression systems can be employed, with E. coli being the most commonly used heterologous host for membrane proteins. Based on successful approaches with homologous proteins, an effective expression strategy would include:

  • E. coli BL21(DE3) or C41(DE3)/C43(DE3) strains: These strains are engineered for membrane protein expression, with the latter specifically designed to mitigate toxicity issues.

  • Expression vectors: pET series vectors with a His-tag fusion (N-terminal or C-terminal) facilitate purification and detection .

  • Induction parameters: Lower temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.5 mM) often improve membrane protein folding and reduce inclusion body formation.

For advanced applications requiring post-translational modifications or alternative folding environments, expression in Lactococcus lactis might be considered, as this system has been successfully used for the functional expression of E. coli MsbA . This approach is particularly valuable when studying drug interactions or when the native LPS environment might interfere with functional studies .

What are the most effective methods for solubilizing and purifying recombinant P. syringae MsbA?

Purification of recombinant P. syringae MsbA requires careful consideration of detergent selection and purification conditions to maintain protein structure and function:

Solubilization protocol:

  • Membrane preparation: Harvest cells and disrupt by sonication or French press in buffer containing protease inhibitors.

  • Membrane isolation: Centrifuge lysate (low speed to remove debris, high speed to collect membranes).

  • Detergent solubilization: Solubilize membranes using mild detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin at 1-2% (w/v) for 1-2 hours.

Purification steps:

  • Immobilized metal affinity chromatography (IMAC): His-tagged MsbA can be purified using Ni-NTA resin, with careful optimization of imidazole concentrations to minimize non-specific binding while maximizing target protein recovery.

  • Size exclusion chromatography (SEC): Further purification using SEC removes aggregates and provides information about the oligomeric state.

  • Buffer optimization: Final buffer typically contains lower detergent concentrations (0.02-0.05% DDM or LMNG) and stabilizing agents like glycerol.

For functional studies, reconstitution into nanodiscs or liposomes may be necessary to study transport activity, using E. coli lipids or synthetic lipid mixtures that mimic the P. syringae membrane environment .

How can researchers verify the structural integrity and functionality of purified recombinant MsbA?

Multiple complementary approaches should be employed to verify both structural integrity and functional activity of purified P. syringae MsbA:

Structural integrity verification:

Functional verification:

  • ATPase activity assay: Measures ATP hydrolysis capacity using a malachite green or coupled enzyme assay

  • Lipid A binding assay: Evaluates interaction with lipid A using isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR)

  • Transport assays: Reconstitution into liposomes to measure transport of fluorescent substrates like ethidium bromide or Hoechst 33342

  • Drug binding studies: Based on homology with other MsbA proteins, interaction with drugs like erythromycin, vinblastine, or other antibiotics could be assessed

The combination of these approaches provides comprehensive validation of both protein structure and function before proceeding with more detailed mechanistic studies.

What structural features distinguish P. syringae MsbA from homologs in other bacterial species?

While high-resolution structural data specific to P. syringae MsbA is not currently available, comparative analysis with MsbA structures from other bacteria suggests several potential distinguishing features:

  • Transmembrane domain (TMD) variations: The six transmembrane helices that form the substrate binding pocket likely contain amino acid substitutions that accommodate the specific LPS structure of P. syringae.

  • Nucleotide-binding domain (NBD) conservation: The ATP-binding cassettes are typically more conserved, maintaining the Walker A/B motifs and signature sequence necessary for ATP binding and hydrolysis.

  • Substrate binding pocket adaptations: As a plant pathogen, P. syringae MsbA may have evolved to interact with different antimicrobial compounds compared to human pathogens, potentially resulting in structural adaptations in the binding pocket.

  • Inter-domain interfaces: The communication between NBDs and TMDs through coupling helices may show differences that influence the conformational changes during the transport cycle.

Molecular modeling based on homologous structures (like the MsbA crystal structure from Salmonella enterica) combined with sequence analysis could help identify these distinctive features prior to experimental structure determination .

How do substrate specificity and transport kinetics of P. syringae MsbA compare with other characterized MsbA proteins?

The substrate specificity and transport kinetics of P. syringae MsbA likely reflect adaptations to its ecological niche as a plant pathogen. Based on comparative analysis with well-characterized MsbA proteins:

Substrate specificity differences:

  • Primary substrate: While all MsbA proteins transport lipid A, variations in P. syringae lipid A structure may affect binding affinity and transport efficiency.

  • Secondary substrates: P. syringae MsbA may have evolved to transport plant-derived antimicrobial compounds, potentially showing different drug interaction profiles compared to homologs from human pathogens.

Kinetic parameters:

  • For homologous MsbA proteins, transport studies have demonstrated apparent single-site kinetics for substrates like ethidium and Hoechst 33342 .

  • Competitive inhibition patterns have been observed with compounds like vinblastine (Ki values of 16 and 11 μM for ethidium and Hoechst 33342 transport, respectively) .

  • Similar studies with P. syringae MsbA would likely reveal distinctive kinetic parameters reflective of its evolutionary adaptations.

The potential multidrug transport activity of P. syringae MsbA may influence the bacteria's adaptation to different plant hosts, potentially contributing to the observed patterns of host specificity across different P. syringae phylogroups .

What methodologies can be used to study the ATP hydrolysis mechanism of recombinant P. syringae MsbA?

Several complementary approaches can be employed to characterize the ATP hydrolysis mechanism of recombinant P. syringae MsbA:

Biochemical assays:

  • Steady-state ATPase activity measurement using:

    • Malachite green phosphate detection assay

    • Coupled enzyme assay with pyruvate kinase and lactate dehydrogenase

    • Radioactive [γ-32P]ATP hydrolysis assay

  • Nucleotide binding studies:

    • Fluorescent ATP analogs (TNP-ATP) to measure binding affinity

    • Competition assays with non-hydrolyzable ATP analogs (AMP-PNP, ATPγS)

Mutational analysis:

  • Site-directed mutagenesis of conserved motifs:

    • Walker A motif (P-loop): K→M mutations to abolish ATP binding

    • Walker B motif: D→N mutations to allow ATP binding but prevent hydrolysis

    • Signature sequence (LSGGQ): Mutations to disrupt NBD dimerization

Advanced biophysical techniques:

  • Pre-steady-state kinetics using rapid mixing techniques:

    • Stopped-flow spectroscopy to measure conformational changes upon ATP binding

    • Quenched-flow to measure initial rates of ATP hydrolysis

  • Structural approaches:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to monitor conformational changes during the ATPase cycle

    • EPR spectroscopy with site-directed spin labeling to track domain movements

These approaches would provide insights into the energy coupling mechanism between ATP hydrolysis and substrate transport, potentially revealing adaptations specific to P. syringae.

How can recombinant P. syringae MsbA be used to study bacterial virulence mechanisms?

Recombinant P. syringae MsbA can serve as an important tool for understanding virulence mechanisms through several experimental approaches:

Genetic manipulation studies:

  • Complementation experiments: Introduction of recombinant MsbA into P. syringae strains with MsbA mutations or deletions to assess restoration of virulence in plant infection models .

  • Site-directed mutagenesis: Creating specific mutations in MsbA to evaluate their impact on LPS transport, membrane integrity, and virulence.

Host-pathogen interaction studies:

  • Seed infection assays: Comparing virulence of wild-type and MsbA-modified strains using established protocols (e.g., soaking seeds in bacterial suspensions of OD600 0.001, monitoring plant growth parameters after 14 days) .

  • Syringe infiltration assays: Quantifying bacterial growth in planta by measuring colony-forming units from leaf discs collected post-infiltration .

Biochemical approaches:

  • LPS transport assays: Measuring transport of fluorescently labeled LPS precursors to assess MsbA efficiency.

  • Plant antimicrobial resistance: Evaluating resistance to plant-derived antimicrobial compounds in strains with wild-type versus modified MsbA.

These studies would contribute to understanding how P. syringae adapts to different plant hosts, potentially explaining the observed differences in host specificity between phylogroups as reported in recent comparative genomic studies .

What approaches can be used to identify potential inhibitors of P. syringae MsbA for agricultural applications?

Identifying inhibitors of P. syringae MsbA could provide new strategies for controlling bacterial diseases in crops. A comprehensive inhibitor discovery pipeline would include:

Screening approaches:

  • High-throughput ATPase inhibition assay:

    • Colorimetric detection of phosphate release using purified recombinant MsbA

    • Testing compound libraries enriched for structural similarities to known ABC transporter inhibitors

  • Transport inhibition assays:

    • Measuring inhibition of fluorescent substrate transport in MsbA-containing proteoliposomes

    • Using ethidium bromide or Hoechst 33342 as reporter substrates

Structure-based approaches:

  • Virtual screening:

    • Molecular docking against homology models of P. syringae MsbA

    • Focusing on nucleotide-binding domains or transmembrane substrate binding sites

  • Fragment-based drug discovery:

    • NMR or thermal shift assays to identify fragment hits

    • Growing or linking fragments to develop higher-affinity compounds

Validation pipeline:

  • In vitro confirmation using purified protein:

    • IC50 determination for ATPase activity inhibition

    • Binding affinity measurement using ITC or SPR

    • Mechanism of inhibition characterization (competitive, non-competitive, uncompetitive)

  • In vivo efficacy testing:

    • Growth inhibition assays with P. syringae strains

    • Plant infection models to assess disease prevention

  • Specificity assessment:

    • Testing against MsbA from beneficial bacteria to assess selectivity

    • Evaluating toxicity against plant cells

This systematic approach could identify compounds that selectively inhibit P. syringae MsbA, potentially leading to new agricultural control strategies.

How can evolutionary analysis of MsbA across P. syringae pathovars inform our understanding of host adaptation?

Evolutionary analysis of MsbA across different P. syringae pathovars can provide valuable insights into bacterial adaptation to different plant hosts:

Comparative genomics approach:

  • Sequence analysis across phylogroups:

    • Comparing MsbA sequences from different P. syringae pathovars to identify conserved and variable regions

    • Correlating sequence variations with host specificity patterns observed in phylogenetic studies

  • Selection pressure analysis:

    • Calculating dN/dS ratios to identify regions under positive or purifying selection

    • Mapping selection hotspots onto predicted structural models

Recombination and horizontal gene transfer analysis:

  • Identifying recombination events:

    • Analyzing MsbA sequences for evidence of recombination between phylogroups

    • Determining if recombination rates correlate with ecological overlap

  • Synteny analysis:

    • Examining the genomic context of MsbA across pathovars

    • Identifying mobile elements or genomic islands that might influence MsbA function

Functional validation:

  • Domain swapping experiments:

    • Creating chimeric MsbA proteins with domains from different pathovars

    • Testing functionality and host specificity effects

  • Correlation with virulence data:

    • Using machine learning approaches similar to those employed for predicting virulence based on genomic data

    • Identifying specific MsbA features that correlate with host range or virulence levels

This evolutionary perspective would complement the physiological and structural studies of MsbA, potentially revealing how variations in this essential transporter contribute to the remarkable host adaptability observed across the P. syringae species complex .

How might post-translational modifications affect P. syringae MsbA function in different environmental conditions?

Post-translational modifications (PTMs) of MsbA could serve as regulatory mechanisms adapting its function to changing environmental conditions encountered by P. syringae:

Potential PTMs affecting MsbA function:

  • Phosphorylation:

    • Serine/threonine/tyrosine phosphorylation could modulate ATPase activity or substrate specificity

    • Stress-responsive kinases might phosphorylate MsbA in response to plant defense compounds

    • Mass spectrometry analysis of MsbA purified from bacteria grown under different stress conditions could identify relevant phosphorylation sites

  • Oxidative modifications:

    • Cysteine oxidation in response to plant-generated reactive oxygen species

    • Methionine oxidation affecting protein stability or conformation

    • Redox-sensitive regulation could link MsbA activity to the oxidative environment during plant infection

  • Other modifications:

    • Acetylation of lysine residues potentially affecting substrate binding

    • S-nitrosylation in response to nitrosative stress during plant defense responses

Environmental conditions affecting PTM patterns:

  • Plant immune responses:

    • Exposure to reactive oxygen species

    • pH changes in the apoplast during infection

    • Antimicrobial peptides triggering stress responses

  • Temperature variations:

    • Diurnal temperature fluctuations in plants

    • Seasonal temperature changes affecting membrane fluidity and LPS transport requirements

Understanding these PTM-mediated regulatory mechanisms could explain how P. syringae adapts its membrane transport systems during the infection process and reveal new targets for intervention strategies.

What role might MsbA play in horizontal gene transfer and recombination events in P. syringae populations?

MsbA's essential function in membrane biogenesis positions it at a potential intersection with horizontal gene transfer (HGT) and recombination processes in P. syringae:

Potential mechanisms of MsbA involvement:

  • Membrane composition effects:

    • MsbA variants could influence outer membrane properties, potentially affecting DNA uptake efficiency

    • LPS structural variations mediated by MsbA transport could impact cell surface charge and DNA interaction

  • Stress response connection:

    • Altered MsbA function under stress might coincide with increased competence for DNA uptake

    • Connection to SOS response pathways that are known to influence recombination rates

  • Co-evolution with mobile genetic elements:

    • MsbA might interact with proteins encoded by prophages or plasmids

    • Selective pressure on MsbA could influence the maintenance of horizontally acquired genes

Evolutionary implications:

  • Recombination patterns:

    • Analysis of recombination rates across P. syringae phylogroups shows variable patterns that might correlate with MsbA function

    • Differing levels of genetic cohesion between lineages could relate to membrane transport efficiency

  • Host specificity evolution:

    • Acquisition of virulence factors through HGT requires compatible membrane transport systems

    • MsbA adaptations might enable or constrain the functional integration of newly acquired genes

Experimental approaches combining population genomics with functional characterization of MsbA variants could illuminate how this essential transporter influences the remarkable genetic diversity observed in P. syringae natural populations .

How do interactions between MsbA and other membrane proteins affect LPS transport and antibiotic resistance in P. syringae?

The function of MsbA in P. syringae likely depends on a complex network of protein-protein interactions within the bacterial membrane:

Potential interaction partners:

  • LPS biosynthesis machinery:

    • Interactions with LpxK, LpxL, or other enzymes involved in lipid A biosynthesis

    • Coordination with inner membrane LPS assembly components

  • Outer membrane transport proteins:

    • Potential coupling with LptD/E complex for LPS transfer to the outer membrane

    • Interactions with other ABC transporters involved in envelope biogenesis

  • Multiprotein resistance complexes:

    • Association with RND-type efflux pumps for cooperative antibiotic resistance

    • Integration with stress response systems detecting envelope damage

Methods to characterize the interactome:

  • Pull-down assays:

    • Affinity purification using tagged MsbA followed by mass spectrometry

    • In vivo crosslinking to capture transient interactions

  • Bacterial two-hybrid screening:

    • Systematic screening for MsbA interactors

    • Validation of interactions using bimolecular fluorescence complementation

  • Genetic interaction mapping:

    • Synthetic lethality screening to identify genes functionally linked to MsbA

    • Suppressor mutation analysis to identify compensatory pathways

Functional consequences of interactions:

  • Regulatory effects:

    • Interactions potentially modulating MsbA ATPase activity or substrate specificity

    • Co-regulation of multiple resistance mechanisms during stress

  • Compositional effects on resistance:

    • Altered LPS composition affecting antibiotic penetration

    • Coordination with phospholipid distribution affecting membrane permeability

Delineating this interaction network would provide a systems-level understanding of membrane transport processes in P. syringae and potentially reveal new targets for controlling bacterial plant diseases.

What are common challenges in recombinant expression of P. syringae MsbA and how can they be addressed?

Researchers working with recombinant P. syringae MsbA commonly encounter several challenges that can be addressed through systematic optimization:

Challenge 1: Low expression levels

  • Possible causes: Codon usage bias, protein toxicity, or promoter inefficiency

  • Solutions:

    • Codon optimization for expression host

    • Tight regulation using inducible promoters (trc, araBAD)

    • Lower growth temperature (16-20°C) during induction

    • Use of specialized expression strains (C41/C43, Lemo21)

    • Testing different fusion partners (MBP, SUMO) to improve solubility

Challenge 2: Protein misfolding and aggregation

  • Possible causes: Rapid expression rate, improper membrane insertion, detergent incompatibility

  • Solutions:

    • Reduced inducer concentration (0.1-0.2 mM IPTG)

    • Addition of glycerol (5-10%) to growth media

    • Inclusion of specific lipids during membrane solubilization

    • Systematic screening of different detergents for solubilization

    • Addition of chemical chaperones to growth media

Challenge 3: Poor protein stability after purification

  • Possible causes: Detergent-induced destabilization, co-factor loss, protease contamination

  • Solutions:

    • Optimization of buffer components (pH 7.0-8.0, NaCl 100-300 mM)

    • Addition of stabilizers (glycerol, specific lipids)

    • Testing detergent exchange during purification

    • Inclusion of ATP or non-hydrolyzable analogs

    • Thorough protease inhibitor coverage during purification

Challenge 4: Loss of functional activity

  • Possible causes: Detergent effects, essential lipid removal, conformational changes

  • Solutions:

    • Reconstitution into nanodiscs or liposomes

    • Addition of P. syringae lipid extracts during purification

    • Minimizing time between purification and functional assays

    • Stabilization in ATP-bound state during purification

Implementing these solutions through systematic optimization can significantly improve the yield and quality of recombinant P. syringae MsbA for subsequent functional and structural studies.

How should researchers interpret discrepancies between in vitro and in vivo functional data for P. syringae MsbA?

Reconciling differences between in vitro and in vivo experimental results for P. syringae MsbA requires careful consideration of multiple factors:

Sources of potential discrepancies:

  • Environmental differences:

    • In vitro systems lack the complex membrane environment present in vivo

    • Absence of native lipid composition in reconstituted systems

    • Different ion concentrations and pH compared to bacterial cytoplasm

  • Interaction partners:

    • Missing protein-protein interactions that may regulate MsbA in vivo

    • Absence of native LPS or lipid substrates in purified systems

    • Loss of potential accessory proteins during purification

  • Regulatory effects:

    • In vivo post-translational modifications absent in recombinant systems

    • Metabolic feedback loops missing in simplified in vitro assays

    • Growth phase-dependent regulation not captured in purified protein studies

Reconciliation strategies:

  • Bridging experiments:

    • Membrane vesicle studies as intermediate between purified protein and whole cells

    • Genetic complementation with mutants to validate in vitro observations

    • Expression of MsbA variants with altered in vitro properties to test phenotypes

  • System complexity gradient:

    • Systematic addition of components (specific lipids, interacting proteins)

    • Comparison across multiple expression systems (E. coli, L. lactis, native P. syringae)

    • Membrane mimetic comparison (detergent vs. nanodiscs vs. liposomes)

  • Functional context assessment:

    • Integration of data from multiple functional assays

    • Correlation analysis between different measurement techniques

    • Consideration of physiological relevance of assay conditions

Understanding these factors allows researchers to develop more accurate models that integrate both in vitro mechanistic insights and in vivo physiological relevance, ultimately leading to a more complete understanding of MsbA function in P. syringae.

What statistical approaches are most appropriate for analyzing transport kinetics data from recombinant P. syringae MsbA experiments?

Robust statistical analysis is crucial for interpreting transport kinetics data from recombinant P. syringae MsbA experiments:

Recommended statistical approaches:

  • For primary transport data analysis:

    • Michaelis-Menten kinetics fitting to determine Km and Vmax parameters

    • Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf transformations for visualization of kinetic parameters

    • Non-linear regression for direct fitting of enzyme kinetics models

  • For inhibition studies:

    • Dixon plots to determine inhibition constants (Ki)

    • Global fitting of competitive, non-competitive, or mixed inhibition models

    • IC50 determination with appropriate conversion to Ki values using the Cheng-Prusoff equation

  • For comparing experimental conditions:

    • ANOVA with appropriate post-hoc tests for multiple condition comparisons

    • Mixed-effects models when dealing with nested experimental designs

    • Bootstrap resampling for robust confidence interval estimation

Statistical validation requirements:

  • Replication standards:

    • Minimum of three independent protein preparations

    • Technical replicates (n≥3) for each measurement

    • Power analysis to determine appropriate sample size

  • Quality control metrics:

    • Coefficient of variation (CV) reporting for technical replicates

    • Goodness-of-fit reporting (R², sum of squares)

    • Residual analysis to validate model assumptions

  • Data transformation considerations:

    • Assessment of normality before applying parametric tests

    • Appropriate transformation (log, square root) when necessary

    • Consideration of weighted regression for heteroskedastic data

Specialized approaches for complex kinetics:

  • For biphasic or complex kinetics:

    • Model comparison using Akaike Information Criterion (AIC)

    • F-test for nested models to determine appropriate complexity

    • Global fitting across multiple datasets with shared parameters

  • For time-course data:

    • Initial rate determination using linear regression of early time points

    • Progress curve analysis for detecting product inhibition or time-dependent effects

    • Integration of differential equations for complex transport models

These statistical approaches ensure robust interpretation of transport kinetics data, allowing meaningful comparisons between different experimental conditions and accurate determination of mechanistic parameters for recombinant P. syringae MsbA.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.