Recombinant Pseudomonas syringae pv. tomato Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pseudomonas syringae pv. tomato Monofunctional Biosynthetic Peptidoglycan Transglycosylase (mtgA)

Recombinant Pseudomonas syringae pv. tomato Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a recombinant enzyme produced through in vitro expression systems, typically in Escherichia coli. This enzyme is involved in the biosynthesis of peptidoglycan, a critical component of bacterial cell walls. Peptidoglycan transglycosylases play a crucial role in the assembly and maintenance of the bacterial cell wall by catalyzing the formation of glycosidic bonds between sugar molecules in peptidoglycan.

Function and Importance of Peptidoglycan Transglycosylases

Peptidoglycan transglycosylases are essential for bacterial cell wall synthesis. They facilitate the polymerization of peptidoglycan precursors into the bacterial cell wall, ensuring structural integrity and maintaining osmotic stability. In pathogens like Pseudomonas syringae, these enzymes are vital for survival and pathogenicity, as they enable the bacteria to withstand environmental stresses and host immune responses.

Characteristics of Recombinant mtgA

  • Source: The recombinant mtgA is produced in an in vitro E. coli expression system, which allows for controlled production and purification of the enzyme .

  • Function: As a monofunctional biosynthetic peptidoglycan transglycosylase, mtgA is involved in the synthesis of peptidoglycan by catalyzing the formation of glycosidic bonds.

  • Genetic Information: The gene encoding mtgA in Pseudomonas syringae pv. tomato is identified as PSPTO_0431 in the KEGG database .

References

  1. Pseudomonas syringae Lytic Transglycosylases Coregulated with Type III Secretion System. PMC2168667.

  2. Hcp2, a Secreted Protein of the Phytopathogen Pseudomonas syringae pv. Tomato DC3000. ASM Journal.

  3. Recombinant Pseudomonas syringae pv. tomato Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA). Cusabio.

  4. Identification of Harpins in Pseudomonas syringae pv. tomato. ASM Journal.

  5. Virulence of Pseudomonas syringae pv. tomato DC3000 Is Influenced by the Catabolite Repression Control Protein Crc. APS Journal.

  6. Virulence of Pseudomonas syringae pv. tomato DC3000. APS Journal.

  7. Deletions in the Repertoire of Pseudomonas syringae pv. tomato. PMC2663052.

  8. A Pseudomonas syringae pv. tomato avrE1/hopM1 Mutant Is Reduced in Virulence. APS Journal.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Shipping defaults to blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mtgA; PSPTO_0431; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-236
Protein Length
full length protein
Species
Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Target Names
mtgA
Target Protein Sequence
MLQIILRRLMKALLWFAAGSALVVLVLRWVPPPGTALMVERKVESWFDGEPIDLQRDWEP WDKISNNLKIAVIAGEDQKFAEHWGFDVDAIQAAILHNEQGGSIRGASTLSQQVSKNLFL WSGRSYLRKGLEAWFTMLIELLWSKERILEVYLNSVEWDEGIFGAQAAAQHHFRTNASAL SEQQASYLAAVLPNPRQWSASHPSGYVSRRAGWIRQQMRQLGGDEYLQGLNSSRRW
Uniprot No.

Target Background

Function

This recombinant Pseudomonas syringae pv. tomato Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.

Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is MtgA and what role does it play in bacterial cell wall synthesis?

MtgA (Monofunctional peptidoglycan glycosyltransferase) is an enzyme that catalyzes glycan chain elongation of bacterial cell walls. Unlike bifunctional penicillin-binding proteins (PBPs) that possess both transglycosylase and transpeptidase activities, MtgA specifically performs the glycosyltransferase function in peptidoglycan synthesis. This enzyme is critical for the assembly of the peptidoglycan layer, which provides structural integrity to bacterial cells. In bacteria like Escherichia coli, MtgA has been shown to localize at the division site under specific conditions, suggesting its involvement in cell division processes . The enzyme's activity can be demonstrated in vitro through peptidoglycan polymerization assays using labeled lipid II substrates, with studies showing significant increases in polymerization when MtgA is overexpressed .

How does MtgA interact with other cell division proteins in bacteria?

MtgA demonstrates specific interactions with several key components of the bacterial divisome complex. Bacterial two-hybrid analyses have revealed that MtgA interacts specifically with PBP3 (a division-specific transpeptidase), FtsW (a putative lipid II flippase), and FtsN (a cell division protein that stimulates peptidoglycan synthesis) . The interaction between MtgA and PBP3 requires the transmembrane segment of PBP3, indicating the importance of membrane association for this interaction. Interestingly, MtgA also demonstrates self-interaction in vivo, suggesting it may function as a dimer or multimer during cell wall synthesis . The interaction network suggests that MtgA collaborates with these divisome proteins to synthesize peptidoglycan at the new poles during bacterial cell division, potentially compensating for the absence of other peptidoglycan synthases like PBP1b in certain genetic backgrounds.

What expression systems are most effective for producing recombinant MtgA for research?

When expressing recombinant MtgA, E. coli is the preferred heterologous expression system due to its genetic tractability and rapid growth. For functional studies, fusion constructs with reporter proteins such as GFP can be created to track localization and expression levels. Based on experimental evidence, plasmid-based expression systems using inducible promoters (such as those in pTV118N vectors) have been successfully employed to control MtgA expression levels . When designing expression systems, researchers should consider including affinity tags (like His6) for purification while ensuring these modifications don't interfere with enzymatic activity. For membrane-associated proteins like MtgA, special consideration should be given to membrane extraction conditions using appropriate detergents. Solubility screening is recommended to determine optimal conditions for obtaining functionally active enzyme.

What is the relationship between MtgA activity and bacterial cell size regulation?

MtgA deletion has been directly linked to significant changes in bacterial cell morphology, particularly cell enlargement. Studies with E. coli have demonstrated that disruption of the mtgA gene leads to the development of "fat cells" with increased volume . This phenotypic change coincides with enhanced polymer accumulation, specifically increased production of biodegradable polymers like P(LA-co-3HB). Quantitative analysis shows that mtgA deletion mutants produced approximately 35% more polymer (7.0 g/l) compared to parent strains (5.2 g/l) . Complementation experiments, where mtgA was reintroduced, reversed these phenotypic changes, confirming that MtgA disruption was directly responsible for the observed effects. This relationship between cell wall synthesis and polymer accumulation reveals a previously unrecognized connection between peptidoglycan metabolism and cellular resource allocation.

How does MtgA from Pseudomonas syringae differ from homologs in other bacterial species?

While both Pseudomonas syringae and E. coli possess MtgA homologs that function as monofunctional glycosyltransferases, they exhibit species-specific differences in regulation and integration with pathogenicity factors. In P. syringae, cell wall metabolism likely interfaces with the type III secretion system that delivers effector proteins into plant hosts . This connection between cell wall synthesis and virulence mechanisms is less prominent in non-pathogenic E. coli strains. Comparative sequence analysis reveals conserved catalytic domains alongside variable regions that may mediate species-specific protein-protein interactions. The integration of MtgA within divisome complexes appears to be conserved across species, though the specific interaction partners may vary. These differences highlight the evolutionary adaptation of core cellular machinery to support specialized bacterial lifestyles, whether pathogenic or commensal.

How can researchers effectively study MtgA enzymatic activity in vitro?

To assess MtgA glycosyltransferase activity in vitro, researchers should employ a lipid II polymerization assay. This method requires:

  • Substrate preparation: Radiolabeled lipid II (e.g., [14C]GlcNAc-labeled lipid II, 9,180 dpm/nmol) serves as the primary substrate .

  • Reaction conditions: Typical reactions contain 1.2 nmol radiolabeled lipid II, 15% dimethyl sulfoxide, 10% octanol, 50 mM HEPES (pH 7.0), 0.5% decyl-polyethylene glycol, and 10 mM CaCl2 .

  • Enzyme addition: Purified MtgA or MtgA fusion proteins (e.g., GFP-MtgA) at concentrations ranging from 0.1-1 μM.

  • Product analysis: Separate reaction products using thin-layer chromatography or size-exclusion chromatography, followed by scintillation counting to quantify polymerized material.

  • Verification: Confirm the peptidoglycan nature of products through lysozyme digestion, which should completely degrade the polymerized material .

This approach has been validated in studies showing a 2.4-fold increase in peptidoglycan polymerization when GFP-MtgA is overexpressed compared to controls (26% versus 11% of lipid II substrate utilized) .

What techniques can be used to investigate MtgA protein-protein interactions in bacterial cells?

The investigation of MtgA protein-protein interactions requires multiple complementary approaches:

  • Bacterial two-hybrid system: This method has successfully identified interactions between MtgA and divisome proteins. The assay uses plasmid pairs encoding T18 and T25 fragments of adenylate cyclase fused to potential interaction partners . Positive interactions reconstitute adenylate cyclase activity, producing cAMP that activates reporter genes. For MtgA studies, researchers should use constructs like T18-(G4S)3-MtgA paired with T25 fusions of divisome proteins.

  • Co-immunoprecipitation: This technique can verify interactions identified by two-hybrid screening under more native conditions. When performing co-IP for membrane proteins like MtgA, careful optimization of detergent conditions is crucial to maintain protein-protein interactions.

  • Fluorescence microscopy with dual labeling: Use fluorescent protein fusions with spectrally distinct fluorophores (e.g., GFP-MtgA and mCherry-PBP3) to visualize co-localization in living cells. Time-lapse imaging during cell division is particularly informative.

  • FRET (Förster Resonance Energy Transfer): This approach can detect direct protein-protein interactions at nanometer resolution, providing spatial information not available from two-hybrid assays.

Interaction PartnerRelative Interaction Strength*Required Domains
PBP313-fold over negative controlTransmembrane segment required
FtsW10-fold over negative controlNot determined
FtsN8-fold over negative controlNot determined
MtgA (self)7-fold over negative controlNot determined

*Based on β-galactosidase activity in bacterial two-hybrid assays

How should researchers approach the analysis of cellular effects following MtgA deletion or overexpression?

When analyzing the effects of MtgA manipulation, researchers should implement the following multi-parameter approach:

  • Growth curve analysis: Monitor bacterial growth rates in standard media and under various stress conditions. Document lag phase duration, doubling time, and maximum OD600.

  • Morphological characterization:

    • Phase contrast microscopy to assess cell shape and size changes

    • Fluorescence microscopy with membrane and DNA stains

    • Quantitative image analysis measuring cell length, width, and volume

    • Transmission electron microscopy for detailed cell envelope structure

  • Biochemical assays:

    • Measure polymer production using extraction and gravimetric analysis

    • Analyze polymer composition through NMR or GC-MS

    • Quantify cell wall precursors using HPLC

  • Complementation studies: To confirm phenotype specificity to MtgA, express wild-type MtgA in deletion strains using controlled expression systems .

For polymer production analysis following MtgA deletion, researchers have documented the following results:

StrainPolymer Production (g/l)LA/3HB RatioCell Size Phenotype
Parent recombinant5.2Not significantly alteredNormal
mtgA deletion mutant7.0Not significantly alteredEnlarged ("fat cell")
Complemented strainSimilar to parentNot significantly alteredNormal

This comprehensive analytical approach enables researchers to fully characterize the consequences of MtgA modulation on bacterial physiology and polymer metabolism .

What are the common challenges in purifying active recombinant MtgA and how can they be addressed?

Purification of active recombinant MtgA presents several challenges:

  • Membrane association: MtgA contains transmembrane domains that complicate extraction and purification. Researchers should screen multiple detergents (CHAPS, DDM, Triton X-100) at varying concentrations to identify optimal solubilization conditions. Alternatively, truncated constructs lacking transmembrane regions may be engineered, though these must be validated for retained enzymatic activity.

  • Protein stability: MtgA often shows reduced stability in purified form. Adding glycerol (10-20%) and reducing agents to all buffers can improve stability. Storage at -80°C in single-use aliquots is recommended to avoid freeze-thaw cycles.

  • Co-purifying contaminants: Endogenous E. coli cell wall enzymes may co-purify with MtgA. Stringent washing steps with increasing imidazole gradients for His-tagged constructs and ion-exchange chromatography as a secondary purification step can reduce contaminants.

  • Activity verification: Following purification, enzymatic activity should be verified using the lipid II polymerization assay described earlier. If activity is low, try different buffer conditions (pH range 6.5-8.0) and test various divalent cation concentrations (Mg2+, Ca2+, Mn2+).

  • Expression optimization: Consider testing multiple E. coli expression strains (BL21, C41/C43 for membrane proteins) and lower induction temperatures (16-25°C) to improve the yield of correctly folded protein.

How can researchers differentiate between direct and indirect effects of MtgA deletion on cellular physiology?

Distinguishing direct from indirect effects of MtgA deletion requires a systematic approach:

  • Time-course analysis: Monitor changes following inducible MtgA depletion to differentiate primary (rapid) from secondary (delayed) effects.

  • Domain-specific mutations: Engineer point mutations in MtgA's catalytic domain versus structural regions to separate enzymatic activity effects from protein-protein interaction effects.

  • Transcriptome and proteome analysis: Perform RNA-seq and proteomic analysis on MtgA deletion strains to identify altered gene expression patterns that may explain observed phenotypes.

  • Suppressor screening: Identify secondary mutations that suppress the MtgA deletion phenotype to reveal genetic pathways connected to MtgA function.

  • Metabolic flux analysis: Use isotope-labeled precursors to track changes in cell wall precursor metabolism and carbon flux in MtgA mutants.

  • Epistasis analysis: Create double mutants combining MtgA deletion with related peptidoglycan synthesis genes to determine pathway relationships.

Researchers have observed that MtgA deletion leads to both cell enlargement and increased polymer production, but the causal relationship between these phenotypes remains unclear . Careful analysis suggests the primary effect is altered peptidoglycan synthesis which subsequently affects cell size, potentially creating conditions that favor polymer accumulation through metabolic redirection.

What are the key considerations when obtaining or sharing recombinant MtgA or related materials for research?

When exchanging materials related to recombinant MtgA research, researchers should consider the following guidelines based on established material transfer practices:

  • Necessity of Materials Transfer Agreements (MTAs): MTAs are essential when transferring proprietary materials, materials maintained as confidential, infectious or hazardous substances, or when providers wish to obtain rights to research results .

  • Problematic MTA terms to avoid:

    • Restrictions on academic freedom, such as publication limitations

    • Excessive rights of ownership in research results

    • Inappropriate indemnification requirements

    • Terms creating conflicting obligations with other funding sources or materials

  • Specific considerations for recombinant MtgA research:

    • Clearly define whether the agreement covers just the gene construct or also includes expression systems and protocols

    • Specify the permitted research applications (e.g., structural studies, activity assays, in vivo localization)

    • Address derivative materials created through protein engineering or fusion proteins

  • Ownership of combination materials: When MtgA constructs are combined with other research tools (e.g., creating GFP-MtgA fusions), ownership determinations become complex. MTAs should clearly address the intellectual property rights for such combinations .

  • International considerations: For international collaborations, export control regulations may apply, particularly for materials with potential agricultural applications given P. syringae's status as a plant pathogen.

How can researchers collaborate effectively on interdisciplinary MtgA studies?

Successful interdisciplinary research on MtgA involves bridging multiple research specialties:

  • Complementary expertise teams: Form collaborations combining:

    • Structural biologists for protein structure determination

    • Microbiologists for phenotypic characterization

    • Biochemists for enzyme activity assays

    • Plant pathologists for understanding P. syringae pathogenesis

    • Biotechnologists for polymer production applications

  • Data sharing platforms: Establish secure platforms for sharing raw data, protocols, and analysis pipelines between collaborators.

  • Regular communication: Schedule consistent meetings with documented action items and results updates. For complex projects, consider project management software to track milestones.

  • Standardized protocols: Develop and share detailed protocols to ensure experimental consistency across different laboratories. Include positive and negative controls for validation.

  • Material standardization: Use consistent bacterial strains, plasmid constructs, and protein preparations to minimize variation between research groups.

  • Authorship and intellectual property agreements: Establish clear guidelines for authorship and potential intellectual property early in the collaboration to prevent later conflicts.

What are the emerging research questions regarding MtgA's role in bacterial pathogenesis and antibiotic resistance?

Several promising research directions are emerging at the intersection of MtgA function, bacterial pathogenesis, and antibiotic resistance:

  • MtgA as a potential therapeutic target: Given its essential role in cell wall synthesis, researchers should investigate whether specific inhibitors of MtgA could serve as novel antibiotics. Structure-based drug design approaches focusing on the unique features of monofunctional glycosyltransferases compared to bifunctional PBPs may yield selective inhibitors.

  • Connections to Type III secretion system: In Pseudomonas syringae, researchers should explore potential functional links between peptidoglycan synthesis mediated by MtgA and the Type III secretion system that delivers effector proteins like HopAF1 into plant hosts . Such connections could reveal how cell wall metabolism coordinates with virulence mechanisms.

  • Role in response to cell wall-targeting antibiotics: Investigation of how MtgA expression and localization change in response to β-lactam antibiotics could provide insights into adaptation mechanisms. Does MtgA upregulation or relocalization contribute to intrinsic or adaptive resistance?

  • Interactions with immune recognition systems: Plant immune systems detect peptidoglycan fragments as microbe-associated molecular patterns (MAMPs). Research should address whether MtgA activity affects the generation or release of such immunogenic fragments during P. syringae infection.

  • Potential roles in biofilm formation: The relationship between MtgA-mediated cell wall synthesis and biofilm architecture remains unexplored. Does altered MtgA expression affect biofilm properties that contribute to persistence in host environments?

How might MtgA research contribute to biotechnology applications beyond understanding bacterial physiology?

The unexpected connection between MtgA deletion and enhanced polymer production opens several biotechnological avenues:

  • Engineered bacterial cell factories: Building on the observation that mtgA deletion enhances polymer production by approximately 35% , researchers could develop optimized bacterial strains with controlled cell wall synthesis for improved biopolymer yields. This approach could be extended to production of other valuable compounds beyond P(LA-co-3HB).

  • Controllable bacterial cell size: The "fat cell" phenotype observed in mtgA deletion mutants suggests potential applications in creating bacteria with customized cell volumes for biotechnology applications. Larger cells might serve as improved platforms for intracellular product accumulation or as microreactors.

  • Synthetic biology applications: MtgA could be incorporated into synthetic genetic circuits where controlled peptidoglycan synthesis serves as a module for regulating cell growth, division, or morphology in response to specific signals.

  • Novel polymer production strategies: Further investigation of the metabolic changes that connect cell wall synthesis to polymer accumulation could reveal new strategies for redirecting carbon flux in bacteria toward valuable products.

  • Peptidoglycan engineering: Understanding MtgA's specific role in glycan chain elongation could enable rational modification of peptidoglycan structure, potentially creating bacteria with customized cell wall properties for specialized applications.

This intersection of fundamental bacterial cell biology with applied biotechnology represents a particularly promising direction for future research in this field.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.