Recombinant Pseudomonas syringae pv. tomato NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pseudomonas syringae pv. tomato NADH-Quinone Oxidoreductase Subunit A (nuoA)

The recombinant Pseudomonas syringae pv. tomato NADH-quinone oxidoreductase subunit A (nuoA) is a bioengineered protein derived from the bacterial pathogen responsible for tomato bacterial speck disease. This enzyme is a critical component of the NADH dehydrogenase I (NDH-1) complex, a proton-pumping respiratory enzyme that initiates electron transport in aerobic respiration. The recombinant version is produced in E. coli with an N-terminal histidine tag (His-tag) for efficient purification via nickel affinity chromatography .

Respiratory Chain Activity

nuoA is part of the 14-subunit NDH-1 complex, which oxidizes NADH to NAD⁺ while pumping protons across the membrane, contributing to the proton motive force . In Pseudomonas species, NDH-1 is essential for:

  • Aerobic respiration: Couples electron transfer to proton translocation.

  • Low-oxygen adaptation: Expression is upregulated under hypoxic conditions, as shown in Pseudomonas fluorescens .

Pathogenicity and Host Interaction

Mutational studies in Pseudomonas fluorescens revealed that NDH-1 (including nuoA) is critical for competitive root colonization . A nuo mutant (PCL1201) exhibited reduced NADH oxidation and impaired colonization of tomato root tips compared to wild-type strains .

Diagnostic and Immunological Studies

Recombinant nuoA is used in enzyme-linked immunosorbent assays (ELISA) to detect anti-bacterial antibodies or study protein-protein interactions . The His-tag simplifies immobilization on assay plates.

Comparative Analysis of NADH Dehydrogenases

In Pseudomonas aeruginosa, three NADH dehydrogenases (NQR, NUO, NDH2) coexist. While P. syringae pv. tomato primarily relies on NUO, studies suggest functional redundancy in other Pseudomonas species:

EnzymeFunctionProton PumpingEnergy Conservation
NUOPrimary NADH:quinone oxidoreductaseYesHigh
NQRSecondary NADH:quinone oxidoreductaseYesModerate
NDH2Backup NADH:quinone oxidoreductaseNoNone

Challenges and Future Directions

  • Stability: Repeated freeze-thaw cycles degrade activity; storage at -20°C/-80°C is recommended .

  • Host Immune Evasion: Mutations in fliC (flagellin) in P. syringae pv. tomato reduce immune detection, suggesting indirect links between metabolic enzymes and virulence .

  • Structural Insights: Crystallography studies on related quinone oxidoreductases (e.g., PtoQOR) could inform substrate-binding models for nuoA .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If a particular tag type is required, please specify it in your order for preferential development.
Synonyms
nuoA; PSPTO_3365; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Target Names
nuoA
Target Protein Sequence
MPESTGLIAHNWGFAIFLLGVVGLCAFMLGLSSLLGSKAWGRSKNEPFESGMLPTGSARL RLSAKFYLVAMLFVIFDIEALFLFAWSVSVRESGWTGFVEALVFIAILLAGLVYLWRVGA LDWAPEGRRNRQAKLKQ
Uniprot No.

Target Background

Function
NDH-1, a NADH-quinone oxidoreductase subunit A (nuoA), facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, ubiquinone is considered the primary electron acceptor. This redox reaction is coupled with proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, thus conserving energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase in Pseudomonas syringae pv. tomato?

NADH-quinone oxidoreductase (also known as NADH dehydrogenase I) is a critical enzyme in the respiratory chain of Pseudomonas syringae pv. tomato. It catalyzes the transfer of electrons from NADH to quinones as part of cellular respiration, contributing to energy generation through the establishment of a proton gradient across the membrane. In P. syringae, the enzyme is encoded by the nuo operon (nuoA through nuoN), with nuoA being one of the essential subunits . Research has demonstrated that NADH dehydrogenase I plays a significant role in bacterial survival and virulence, as mutations in the nuo operon can impair important functions like root colonization in related Pseudomonas species .

How does the nuoA gene fit within the complete nuo operon structure?

The nuoA gene represents the first gene in the nuo operon, which typically spans from nuoA to nuoN in Pseudomonas species. Studies of related Pseudomonas strains have revealed that the complete operon contains a promoter region upstream of nuoA and a transcriptional terminator consensus sequence downstream of nuoN . The operon functions as a single transcriptional unit, with all genes being co-expressed to form the multisubunit NADH dehydrogenase I complex. NuoA specifically encodes a membrane-bound subunit that contributes to the structural integrity and functional capacity of the complete enzyme complex.

What methods are used to confirm successful cloning of recombinant nuoA?

To confirm successful cloning of recombinant nuoA from Pseudomonas syringae pv. tomato, researchers typically employ a combination of the following methods:

  • Restriction enzyme analysis: Digestion of plasmid DNA with appropriate restriction enzymes followed by gel electrophoresis to verify the presence of correctly sized fragments.

  • PCR verification: Using nuoA-specific primers to amplify the insert from the recombinant plasmid.

  • DNA sequencing: To confirm the exact sequence of the cloned gene and ensure no mutations were introduced during the cloning process.

  • Southern blot hybridization: Using a labeled nuoA-specific probe to confirm successful integration, particularly useful for detecting chromosomal insertions .

  • Expression analysis: Western blotting using antibodies against the recombinant protein or an affinity tag to confirm expression.

The detection limit for DNA hybridization probes can be as low as approximately 4 × 10 CFU when using nonradioactive reporter systems .

What expression systems are most suitable for recombinant Pseudomonas syringae pv. tomato nuoA?

The choice of expression system for recombinant P. syringae pv. tomato nuoA depends on research objectives:

Expression SystemAdvantagesLimitationsBest For
E. coli pET systemHigh expression levels, well-established protocolsMay form inclusion bodies, lacks post-translational modificationsProtein structure studies, antibody production
Native P. syringaeNatural post-translational modifications, proper protein foldingLower yield, more complex cultivationFunctional studies, complementation experiments
Broad-host-range vectorsExpression in multiple bacterial speciesVariable expression levelsComparative studies across Pseudomonas species
Inducible promoter systemsControlled expression timingBackground expression, inducer toxicityToxic protein expression, temporal studies

For functional studies, complementation experiments using a broad-host-range vector with the native promoter in a nuoA-deficient strain provides the most physiologically relevant results . For structural studies, heterologous expression in E. coli with appropriate tags has proven successful for related oxidoreductases .

How can researchers measure the enzymatic activity of recombinant NADH-quinone oxidoreductase?

Measuring the enzymatic activity of recombinant NADH-quinone oxidoreductase can be achieved through several spectrophotometric methods:

  • NADH oxidation assay: Monitor the decrease in absorbance at 340 nm, which corresponds to NADH oxidation. The reaction mixture typically contains:

    • 50 mM phosphate buffer (pH 7.5)

    • 200 μM NADH

    • 100 μM ubiquinone or appropriate quinone substrate

    • Purified enzyme or cellular extract

  • Quinone reduction assay: Follow the reduction of quinones such as 1,4-benzoquinone or 9,10-phenanthrenequinone. Studies have shown that P. syringae quinone oxidoreductases have weak activity toward 1,4-benzoquinone but strong reduction activity toward larger substrates like 9,10-phenanthrenequinone .

  • Electron transfer chain coupling: Measure the enzyme's ability to reduce quinones that subsequently feed electrons into the respiratory chain using membrane vesicles or reconstituted systems.

  • Oxygen consumption: Use oxygen electrodes to measure respiration rates in the presence of NADH and various quinones.

Comparative activity assays have shown that the substrate-binding site of PtoQOR (P. syringae pv. tomato quinone oxidoreductase) is wider than that of E. coli and Thermus thermophilus HB8, explaining its preference for larger substrates .

What regulatory considerations apply when working with recombinant Pseudomonas syringae?

Working with recombinant Pseudomonas syringae pv. tomato, particularly when manipulating virulence factors like NADH-quinone oxidoreductase, requires compliance with several regulatory frameworks:

  • NIH Guidelines: Compliance with NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules is mandatory for institutions receiving NIH funding . This applies to all recombinant work regardless of the specific funding source for the project.

  • Institutional Biosafety Committee (IBC) approval: Prior approval from the IBC is required before initiating work with recombinant P. syringae, which is classified as a plant pathogen . Researchers must submit a Memorandum of Understanding and Agreement (MUA) through appropriate institutional channels.

  • Containment considerations: P. syringae work typically requires at minimum Biosafety Level 1 containment, but manipulation of virulence factors may necessitate BSL-2 measures depending on institutional policies .

  • Transparency in reporting: When publishing results, researchers must disclose the use of recombinant techniques, including any gene manipulations of nuoA .

  • Record-keeping requirements: Maintain detailed records of all experimental protocols, risk assessments, and safety measures implemented when working with recombinant P. syringae.

The IBC approval process generally takes 3-4 weeks, and approvals are typically valid for three years with annual review requirements .

How does the expression of nuoA change under different environmental conditions?

The expression of nuoA and the entire nuo operon in P. syringae and related Pseudomonas species shows significant variation under different environmental conditions:

  • Oxygen tension: Studies in Pseudomonas fluorescens have shown that both nuo and ndh promoters (encoding different NADH dehydrogenases) are up-regulated under low oxygen concentrations . This suggests that nuoA expression increases in microaerobic environments, which may be relevant during plant colonization.

  • Growth phase: Transcriptomic analysis reveals that expression patterns of respiratory chain components, including NADH dehydrogenase genes, vary significantly between exponential and stationary growth phases . This growth phase-dependent regulation may help bacteria adapt to changing energy requirements.

  • Host interaction: When P. syringae interacts with host plants or model organisms like C. elegans, significant changes in gene expression occur. While not specifically documenting nuoA regulation, research has shown that genes involved in metabolism and energy production undergo substantial regulation during host interaction .

  • Nutrient availability: The respiratory chain composition, including NADH dehydrogenases, adjusts according to carbon source availability, with different expression patterns observed in nutrient-rich versus nutrient-limited conditions.

This dynamic regulation of nuoA expression highlights its importance in bacterial adaptation to varying environmental conditions during the infection cycle.

What structural differences exist between P. syringae pv. tomato NADH-quinone oxidoreductase and homologous enzymes in other bacteria?

Structural analysis reveals several key differences between P. syringae pv. tomato NADH-quinone oxidoreductase and homologous enzymes in other bacteria:

  • Substrate binding pocket: Crystal structure analysis of related oxidoreductases from P. syringae pv. tomato DC3000 shows a wider substrate-binding site compared to those from E. coli and Thermus thermophilus HB8 . This structural difference explains the enzyme's preference for larger quinone substrates.

  • NADPH binding configuration: In the PtoQOR-NADPH complex, NADPH locates in the groove between two domains, and its binding causes significant conformational changes in the enzyme structure . These changes may differ from those observed in other bacterial NADH dehydrogenases.

  • Subunit organization: While maintaining the core structure, P. syringae NADH dehydrogenase I shows species-specific variations in subunit interactions that may affect electron transfer efficiency and proton pumping capability.

  • Membrane association: The membrane-spanning regions of P. syringae NADH dehydrogenase I, including portions encoded by nuoA, show adaptations that may reflect the specific membrane composition of this plant pathogen.

These structural differences likely contribute to the specific functional properties of P. syringae NADH-quinone oxidoreductase in the context of plant pathogenesis.

How does mutation in nuoA affect virulence and bacterial fitness in planta?

Mutation in nuoA affects multiple aspects of P. syringae virulence and fitness:

  • Energy generation: Disruption of nuoA impairs NADH dehydrogenase I function, reducing ATP generation through oxidative phosphorylation and potentially limiting resources for virulence-associated processes.

  • Root colonization: In related Pseudomonas species, mutations in the nuo operon resulted in approximately 100-fold impairment in competitive root colonization , suggesting a similar effect might occur in P. syringae pv. tomato colonization of tomato plants.

  • Stress tolerance: NADH dehydrogenase I plays a role in maintaining redox balance, and nuoA mutations may reduce bacterial survival under oxidative stress conditions typically encountered during plant infection.

  • Virulence factor expression: The metabolic changes resulting from nuoA mutation can indirectly affect expression of virulence factors. Transcriptomic studies of Pseudomonas during host interaction have demonstrated complex regulatory networks connecting metabolism and virulence .

  • Survival in planta: P. syringae survival in the plant apoplast likely requires functional energy generation systems. Mutations affecting nuoA and respiratory chain function may reduce long-term persistence in plant tissues.

These findings suggest that nuoA could be a potential target for developing novel plant protection strategies against bacterial speck disease.

What are the best methods for creating nuoA knockouts in Pseudomonas syringae pv. tomato?

Creating nuoA knockouts in P. syringae pv. tomato can be achieved through several methodologies, each with specific advantages:

  • Transposon mutagenesis: This approach has been successfully employed in related Pseudomonas species to identify the role of NADH dehydrogenase genes . The method involves:

    • Using transposons like Tn5 or mariner

    • Screening the mutant library for nuoA disruption using PCR

    • Confirming gene inactivation through sequencing

    • Verifying phenotypic changes

  • Homologous recombination: A more targeted approach involving:

    • Cloning regions flanking nuoA into a suicide vector

    • Incorporating an antibiotic resistance cassette between flanking regions

    • Introducing the construct into P. syringae through conjugation or electroporation

    • Selecting for double recombination events

  • CRISPR-Cas9 system: This more recent approach offers precise genome editing:

    • Designing sgRNAs targeting nuoA

    • Introducing a CRISPR-Cas9 delivery vector

    • Creating knockout mutations without antibiotic markers

    • Confirming mutations through sequencing

When screening transposon mutant libraries, researchers have successfully identified genes like acnA, gltP, oprD, and zapE as nematicidal factors in P. syringae , suggesting similar approaches would work for nuoA studies.

How can researchers distinguish between the activities of different NADH dehydrogenases in P. syringae?

Distinguishing between NADH dehydrogenase I (encoded by the nuo operon) and NADH dehydrogenase II (encoded by ndh) activities in P. syringae requires specific experimental approaches:

  • Inhibitor sensitivity:

    • NADH dehydrogenase I is sensitive to rotenone and piericidin A

    • NADH dehydrogenase II is insensitive to these inhibitors but sensitive to flavone

    • Differential inhibition profiles can be used to distinguish their activities

  • Genetic approaches:

    • Create single and double mutants (nuoA and ndh)

    • Compare NADH oxidation activities in membrane preparations

    • Perform complementation studies with cloned genes

  • Promoter activity analysis:

    • Fuse nuo and ndh promoters to reporter genes like lacZ

    • Monitor expression under different conditions

    • Studies in P. fluorescens showed both promoters are up-regulated under low oxygen conditions but with different expression patterns during growth

  • Proton pumping measurement:

    • NADH dehydrogenase I couples electron transfer to proton translocation

    • NADH dehydrogenase II does not pump protons

    • Measure proton gradient formation using pH-sensitive fluorescent probes

  • Substrate specificity:

    • Test different quinone analogs to identify differential substrate preferences

    • Comparative activity with NADH versus NADPH can also help distinguish the enzymes

The activity of both enzymes varies during growth phases and under different environmental conditions, suggesting specialized roles in bacterial metabolism and virulence .

What are the best approaches for studying nuoA's role in plant infection models?

To comprehensively investigate nuoA's role in plant infection, researchers should consider these methodological approaches:

  • Genetic manipulation and complementation:

    • Create nuoA deletion mutants in P. syringae pv. tomato

    • Develop complementation strains with native or modified nuoA

    • Include appropriate controls (wild-type and vector-only)

    • Use site-directed mutagenesis to modify specific functional domains

  • Plant infection assays:

    • Spray inoculation of tomato plants with wild-type and mutant strains

    • Measure bacterial population dynamics in planta over time

    • Assess symptom development (bacterial speck lesions)

    • Quantify virulence through lesion counting and bacterial enumeration

  • Chemotaxis and entry studies:

    • Evaluate the role of NADH dehydrogenase I in bacterial chemotaxis

    • Assess entry efficiency into tomato apoplast

    • GABA and L-Pro perception are known to drive P. syringae entry into tomato apoplast

  • Transcriptomics and metabolomics:

    • Compare transcriptomic profiles of wild-type and nuoA mutants during infection

    • Analyze metabolic changes in both bacteria and host plant

    • Identify compensatory pathways activated in mutant strains

  • Competitive fitness assays:

    • Co-inoculate plants with wild-type and nuoA mutants

    • Determine competitive index over the course of infection

    • Similar approaches have shown a 100-fold reduction in competitive root colonization for nuo mutants in related species

  • Microscopy techniques:

    • Confocal microscopy with fluorescently tagged strains

    • Track bacterial movement and colonization patterns

    • Assess spatial distribution in plant tissues

These multifaceted approaches provide a comprehensive understanding of nuoA's contribution to P. syringae virulence and plant colonization.

How can structural information about P. syringae NADH-quinone oxidoreductase inform the design of targeted antimicrobials?

Structural insights into P. syringae NADH-quinone oxidoreductase can guide antimicrobial development through several approaches:

  • Structure-based inhibitor design:

    • Crystal structures of quinone oxidoreductases from P. syringae pv. tomato DC3000 complexed with NADPH have been determined at 2.01-2.4Å resolution

    • These structures reveal the NADPH binding groove between two domains and the wider substrate-binding pocket compared to other bacterial species

    • Virtual screening can identify compounds predicted to bind the active site

  • Targeting unique structural features:

    • Conformational changes induced by NADPH binding

    • Distinctive substrate preference for larger quinones like 9,10-phenanthrenequinone

    • Plant-pathogen specific adaptations in the enzyme structure

  • Allosteric inhibition strategies:

    • Identify allosteric sites that affect enzyme function

    • Design molecules that lock the enzyme in inactive conformations

    • Focus on regions unique to plant pathogenic bacteria

  • Rational modification of known inhibitors:

    • Using the structural differences between host and pathogen enzymes

    • Modify existing respiratory chain inhibitors for specificity toward P. syringae

    • Enhance uptake properties for delivery to infection sites

These approaches have the potential to develop targeted control agents for bacterial speck disease with reduced environmental impact compared to broad-spectrum bactericides.

What role might nuoA play in the evolution of host range specificity in Pseudomonas syringae pathovars?

The potential role of nuoA in host range evolution of P. syringae pathovars represents an intriguing research direction:

  • Pathovar energy requirements:

    • Different plant hosts may present varying energy landscapes

    • NADH dehydrogenase I composition and efficiency may be adapted to specific host environments

    • nuoA sequence variations might reflect adaptation to different plant species

  • Comparative genomics evidence:

    • P. syringae has been divided into at least 13 phylogroups with varying host ranges

    • Strains within phylogroup I are predominantly isolated from damaged plant tissues

    • Phylogroup II (containing many P. syringae pv. tomato strains) shows the most diversity and contains strains from all known habitats

    • Analysis of nuoA sequence conservation and variation across these phylogroups may reveal selection pressures

  • Co-evolution with host defense responses:

    • Plant hosts produce various oxidative defense compounds

    • NADH dehydrogenase I may play a role in detoxification or stress resistance

    • Pathovar-specific adaptations in nuoA could reflect host-specific defense mechanisms

  • Metabolic adaptation:

    • Different plant hosts provide different carbon and energy sources

    • nuoA variants might optimize energy generation from host-specific metabolites

    • These adaptations could contribute to host range determination

This evolutionary perspective could provide insights into the fundamental mechanisms of plant-pathogen co-evolution and specialization.

How might understanding nuoA function contribute to sustainable agriculture practices?

Understanding nuoA function in P. syringae could contribute to sustainable agriculture through several innovative approaches:

  • Development of targeted biocontrol strategies:

    • Identifying compounds that specifically inhibit P. syringae NADH dehydrogenase I

    • Designing molecules that disrupt energy metabolism only in the pathogen

    • Creating plant-incorporated protectants that target nuoA function

  • Early detection systems:

    • Developing DNA-based detection methods targeting nuoA sequences

    • Creating diagnostic tools for rapid field identification of P. syringae pv. tomato

    • Similar approaches using coronatine-related genes have achieved detection limits of approximately 4 × 10 CFU of bacteria from lesions

  • Resistant crop development:

    • Engineering tomato varieties that interfere with bacterial energy metabolism

    • Developing plants that produce compounds inhibiting NADH dehydrogenase I

    • Creating transgenic plants expressing RNA molecules targeting nuoA expression

  • Ecological management approaches:

    • Understanding environmental factors that modulate nuoA expression

    • Manipulating agricultural conditions to minimize pathogen fitness

    • Studies show P. syringae survival in soil and buried host debris is temperature-dependent

  • Integrated disease management:

    • Combining traditional practices with molecular insights

    • Timing interventions based on nuoA expression patterns in field conditions

    • Creating prediction models incorporating energy metabolism factors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.