Recombinant Pseudomonas syringae pv. tomato NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Applications

Recombinant nuoK is synthesized for research and diagnostic purposes:

  • Expression System: Expressed in E. coli as a full-length protein (1–102 amino acids) fused to an N-terminal His-tag .

  • Storage and Stability: Tris-based buffer with 50% glycerol; stored at -20°C .

Functional Studies and Mutagenesis Insights

Extensive mutagenesis has elucidated the roles of conserved residues:

Glu-36 and Glu-72 Mutations

MutationImpact on ActivityMechanistic ImplicationSource
E36AComplete loss of NDH-1 activityGlu-36 is indispensable for proton translocation
E36 Relocated (E32, E38, E39, E40)Retained activity (~75–90%)Site flexibility in TM2 allows alternative proton pathways
E72AModerate reduction in activityGlu-72 supports but is not essential for proton translocation

Cytosolic Loop-1 Mutations

MutationEffect on ActivityRole of Loop-1Source
R25A/R26ADrastic reduction in proton pumpingStabilizes subunit assembly and proton channel
N27SSlight reduction in electron transferModulates enzyme-substrate interactions

Comparative Analysis with Related Enzymes

While nuoK is distinct from other quinone oxidoreductases, structural parallels exist:

EnzymeKey FeaturesOrganismSource
PtoQOR (zeta-crystallin)NADPH-dependent, reduces large quinones (e.g., 9,10-phenanthrenequinone)Pseudomonas syringae
AzoreductasesBroad substrate specificity; include NAD(P)H quinone oxidoreductase activityPseudomonas aeruginosa

Research and Diagnostic Applications

  • Biochemical Assays: Used to study NDH-1 mechanisms, including proton translocation and electron transfer .

  • Immunoassays: ELISA kits for detecting nuoK in bacterial cultures or host-pathogen interactions .

Genomic Context and Evolution

  • Locus Tag: PSPTO_3374 in Pseudomonas syringae pv. tomato DC3000 .

  • Phylogenetic Distribution: Conserved across Pseudomonas species, with functional redundancy in NDH-1 subunits .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please specify them in your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; PSPTO_3374; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Target Names
nuoK
Target Protein Sequence
MNAIPLEHGLAVAGVLFCLGLVGLMVRRNILFVLMSLEIMMNAAALAFVVAGSRWAQPDG QVMFILVISLAAAEASIGLAILMQLYRRFHTLDIDAASEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thus conserving the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Structural Characteristics of NuoK

  • What is the basic structure of the NuoK subunit in Pseudomonas syringae pv. tomato?

    The NuoK subunit (counterpart of the mitochondrial ND4L subunit) is one of seven hydrophobic subunits in the membrane domain of the H⁺-translocating NADH:quinone oxidoreductase (NDH-1) complex. It contains three transmembrane segments (TM1-3) with two conserved glutamic acid residues located in adjacent transmembrane helices that are critical for energy-coupled activity . The protein's structural organization includes a short cytoplasmic loop between TM1 and TM2 (loop-1) containing important arginine residues (Arg-25, Arg-26) and an asparagine residue (Asn-27) that play significant roles in energy transduction mechanisms .

  • How conserved is the nuoK gene across Pseudomonas syringae pathovars?

    While specific conservation data for nuoK across P. syringae pathovars is limited in the provided resources, analysis of other genes in P. syringae pathovars shows high conservation within lineages. For example, housekeeping genes in P. syringae pv. tomato strains JL1065 and T1 differ in DNA sequence by only 0.4%, while strain DC3000 differs from them by 0.9% . This suggests that functional genes like nuoK may exhibit similar conservation patterns within pathovars, particularly within the same lineage.

  • What are the key functional domains in NuoK that researchers should focus on?

    Research should focus on:

    • The two conserved glutamic acid residues: Particularly Glu-36 in TM2 (highly conserved and crucial for function) and Glu-72 in TM3

    • The cytoplasmic loop-1 between TM1 and TM2, containing Arg-25, Arg-26, and Asn-27, which are important for energy transduction

    • Positions along TM2 (positions 32, 38, 39, and 40) that are in the vicinity of Glu-36 and present in the same helix phase

Recombinant Expression Methods

  • What are the most effective methods for generating recombinant nuoK constructs from Pseudomonas syringae pv. tomato?

    Based on recombineering approaches used with Pseudomonas syringae:

    1. Vector Selection: Use a broad-host-range vector like pUCP24 that has been modified to include:

      • A constitutive promoter (such as BAD nptII promoter)

      • Gateway cassette for efficient cloning

      • Counter-selectable marker (B. subtilis sacB gene) to expedite plasmid elimination post-recombination

    2. Amplification Strategy:

      • Design primers specific to nuoK with appropriate restriction sites

      • PCR amplify the nuoK gene from P. syringae pv. tomato genomic DNA

      • Clone the amplified fragment into the expression vector through restriction-ligation approach

    3. Transformation Protocol:

      • Introduce constructs into P. syringae pv. tomato cells via electroporation

      • Select transformants using appropriate antibiotics

      • Confirm constructs by DNA sequencing before expression studies

  • What expression systems are optimal for functional studies of recombinant NuoK protein?

    For functional studies of recombinant NuoK:

    1. Homologous Expression System:

      • Use P. syringae pv. tomato DC3000 as the expression host for most physiologically relevant results

      • Employ vectors with inducible promoters to control expression levels

      • Utilize the counterselectable marker system (sacB) for subsequent elimination of the expression plasmid

    2. Complementation Approach:

      • Generate nuoK knockout mutants in P. syringae

      • Complement with wild-type or mutant versions of nuoK to assess functionality

      • Measure NDH-1 activity through biochemical assays and growth characteristics

    3. Heterologous Systems:

      • E. coli-based expression may be useful for protein production and purification

      • Consider membrane protein-specific expression systems that account for the hydrophobic nature of NuoK

Mutational Analysis and Structure-Function Relationships

  • How do mutations in conserved residues of NuoK affect energy transduction efficiency?

    Based on the available data:

    MutationLocationEffect on NDH-1 ActivityFunctional Implication
    Glu-36→AlaTM2Complete loss of activityEssential for energy transduction
    Glu-72→AlaTM3Moderate reductionImportant but not essential
    Position shifts of Glu-36 to 32, 38, 39, 40TM2Largely retained activityFunctional flexibility within helix turn
    Mutations in Arg-25, Arg-26 in loop-1Between TM1-TM2Drastic effect on energy transductionCritical role of cytosolic loop

    Experimental evidence indicates that the absolute position of Glu-36 may not be as critical as its presence within the same helical phase. Mutants with Glu-36 shifted to positions 32, 38, 39, and 40 largely retained energy transducing capabilities, suggesting these positions maintain the residue in a functionally competent configuration within the proton translocation pathway .

  • What methodological approaches can be used to study the proton translocation mechanism of recombinant NuoK?

    To investigate proton translocation through NuoK:

    1. Site-Directed Mutagenesis:

      • Target conserved acidic residues (Glu-36, Glu-72) and analyze effects on proton pumping

      • Create scanning mutations across transmembrane domains to identify additional residues involved

    2. Proton Translocation Assays:

      • Use pH-sensitive fluorescent probes to measure proton movement

      • Employ inverted membrane vesicles for directional studies of proton translocation

      • Quantify H⁺/e⁻ stoichiometry under various conditions

    3. Biochemical Coupling Analysis:

      • Measure NADH oxidation rates coupled to proton translocation

      • Assess effects of ionophores and proton gradient dissipators

      • Compare wild-type and mutant variants for uncoupling phenotypes

    4. Structural Studies:

      • Use hydrogen-deuterium exchange mass spectrometry to identify water-accessible regions

      • Apply crosslinking strategies to determine proximity relationships with other subunits

      • Consider cryo-EM approaches for structural determination of the entire NDH-1 complex

Recombineering and Genome Editing Applications

  • How can recombineering techniques be applied to study nuoK function in Pseudomonas syringae pv. tomato?

    Recombineering offers powerful approaches for nuoK studies:

    1. RecTE-Based Recombineering System:

      • Utilize the identified RecT homolog from P. syringae pv. syringae B728a for single-stranded DNA recombination

      • For double-stranded DNA modifications, employ both RecT and RecE homologs together

      • Optimize expression vectors to control recombinase levels during experiments

    2. Point Mutation Introduction:

      • Design oligonucleotides with desired mutations flanked by 40-50 bp homology arms

      • Introduce into cells expressing RecT for single-stranded recombination

      • Select for desired mutations using phenotypic screens or counterselection strategies

    3. Gene Replacement Protocols:

      • Generate PCR products with antibiotic resistance markers flanked by homology regions

      • Transform into RecTE-expressing cells for targeted replacement of nuoK

      • Verify recombinants by PCR and sequencing before functional analysis

    4. Scarless Modification Approach:

      • Use two-step recombineering process with intermediate selection

      • Remove selectable markers using counterselection with sacB

      • Generate unmarked mutations for physiologically relevant studies

  • What are the challenges and solutions for chromosome editing of nuoK in Pseudomonas syringae pv. tomato?

    Key challenges and solutions include:

    1. Efficiency Limitations:

      • Challenge: Low recombination frequencies in Pseudomonas compared to E. coli

      • Solution: Optimize electroporation protocols and use high concentrations of DNA substrates

    2. Selection Strategies:

      • Challenge: Identifying rare recombinants among transformants

      • Solution: Implement dual selection/counterselection systems using antibiotic markers and sacB

    3. Off-Target Effects:

      • Challenge: Unintended recombination at non-target sites

      • Solution: Design recombineering substrates with unique homology regions verified by genome analysis

    4. Strain Variations:

      • Challenge: Different efficiency in various P. syringae pathovars

      • Solution: Adjust protocols for specific strains based on experimental determination of recombination frequencies

    5. Plasmid Elimination:

      • Challenge: Removing recombineering plasmids after modification

      • Solution: Use counterselectable markers like sacB with sucrose selection

Evolutionary and Comparative Analysis

  • How has the nuoK gene evolved across different Pseudomonas syringae pathovars and what are the functional implications?

    While specific nuoK evolution data is limited in the provided resources, insights can be drawn from P. syringae genomic studies:

    1. Pathovar Differentiation:
      P. syringae comprises at least 15 recognized species and more than 60 pathovars with varying host specificities . Functional genes like nuoK may show evolutionary patterns reflecting adaptation to different plant hosts and environmental conditions.

    2. Recent Evolutionary Origin:
      Genome analysis of P. syringae pv. tomato strains revealed only 267 mutations between five sequenced isolates in 3.5 million base pairs, suggesting a recent evolutionary origin for this pathogen . This indicates that essential metabolic genes like nuoK might be highly conserved within pathovars.

    3. Selective Pressure Analysis:
      Similar to the adaptive evolution observed in effector genes (e.g., hopM1) , metabolic genes may show signatures of selection related to host adaptation. For nuoK, selection would likely favor conservation of function while potentially allowing minor variations that optimize energy metabolism for specific niches.

    4. Geographic Distribution Patterns:
      Research shows that P. syringae strains frequently move between world regions . This global spread could impact nuoK evolution through founder effects and geographic isolation, potentially leading to region-specific variants.

  • What comparative genomic approaches are most effective for studying nuoK variation across Pseudomonas species?

    Effective comparative genomic approaches include:

    1. Pan-Genome Analysis:

      • Analyze nuoK sequences across the entire pan-genome of P. syringae (similar to the 494 strains analyzed for effector genes)

      • Identify core and variable regions within the gene

      • Quantify sequence conservation at nucleotide and amino acid levels

    2. SNP-Based Phylogenetic Analysis:

      • Employ methods similar to those used to study T1-lineage evolution

      • Construct phylogenetic trees based on nuoK sequence variations

      • Correlate nuoK variants with ecological niches or host preferences

    3. Selection Pressure Testing:

      • Calculate dN/dS ratios to identify signatures of positive or purifying selection

      • Perform codon-based Z-tests to determine selection type

      • Apply branch-site models to detect lineage-specific selection

    4. Structure-Function Correlation:

      • Map sequence variations onto protein structural models

      • Analyze if variations cluster in specific functional domains

      • Predict functional implications of observed polymorphisms

Experimental Design for NuoK Functional Studies

  • What control experiments are essential when studying recombinant NuoK function?

    Critical control experiments include:

    1. Expression Controls:

      • Vector-only controls to account for plasmid effects

      • Wild-type NuoK expression as positive control

      • Inactive mutant (Glu-36→Ala) as negative control

    2. Functional Assays:

      • Complementation of nuoK deletion strains with wild-type gene to verify restoration of function

      • Biochemical assays with inhibitors to confirm specificity of measured activities

      • Comparison of growth rates under various metabolic conditions to assess physiological relevance

    3. Localization Verification:

      • Membrane fraction analysis to confirm proper insertion of recombinant NuoK

      • Protease accessibility assays to verify correct membrane topology

      • Control proteins with known localization patterns

    4. Plasmid Stability Tests:

      • PCR verification of construct integrity before and after expression

      • Assessment of plasmid retention under non-selective conditions

      • Confirmation of plasmid elimination using counterselection when required

  • How should researchers design experiments to investigate interactions between NuoK and other NDH-1 complex subunits?

    Recommended experimental design approaches:

    1. Co-Immunoprecipitation Studies:

      • Tag NuoK with epitope tags that minimally impact function

      • Perform pull-down experiments to identify interacting partners

      • Use crosslinking prior to solubilization to capture transient interactions

    2. Bacterial Two-Hybrid Analysis:

      • Create fusion constructs of NuoK domains with reporter fragments

      • Test interactions with other NDH-1 subunits systematically

      • Validate positive interactions with alternative methods

    3. Suppressor Mutation Analysis:

      • Introduce deleterious mutations in NuoK

      • Screen for compensatory mutations in other subunits that restore function

      • Map interaction interfaces based on suppressor patterns

    4. Site-Specific Crosslinking:

      • Incorporate photo-activatable amino acids at specific positions in NuoK

      • Identify crosslinked partners by mass spectrometry

      • Map interaction surfaces based on crosslinking patterns

Technical Challenges and Solutions

  • What are the key challenges in expressing and purifying recombinant NuoK protein and how can they be addressed?

    Challenges and solutions for NuoK expression and purification:

    ChallengeSolution ApproachMethodological Details
    Membrane protein solubilityDetergent screeningTest multiple detergent classes (maltoside, glucoside, fos-choline); optimize concentration and buffer conditions
    Proper foldingFusion partnersUse MBP, SUMO or other solubility-enhancing tags; consider inducible chaperone co-expression
    Expression toxicityTight expression controlUse stringent promoters with minimal leaky expression; lower induction temperatures (16-20°C)
    Functional verificationActivity assaysDevelop reconstitution protocols in liposomes; measure electron transport activity
    Protein degradationProtease inhibitionInclude comprehensive protease inhibitor cocktails; optimize purification speed
    Low yieldExpression optimizationTest various media formulations; consider extended expression times at reduced temperatures
  • How can researchers troubleshoot recombineering experiments when modifying the nuoK gene in Pseudomonas syringae pv. tomato?

    Troubleshooting guidelines for recombineering:

    1. Low Recombination Efficiency:

      • Verify RecT/RecE expression levels by Western blot

      • Optimize electroporation parameters (voltage, resistance) for higher transformation efficiency

      • Increase homology arm length (50-100 bp may improve frequency)

    2. False Positive Selection:

      • Implement PCR screening strategies to verify authentic recombinants

      • Use dual selection markers when possible

      • Design primers outside the recombination region to confirm proper integration

    3. Recombinase Expression Issues:

      • Ensure plasmid stability by maintaining selective pressure

      • Verify recombinase expression timing relative to introduction of DNA substrates

      • Consider alternative promoters if expression is problematic

    4. Integration Site Problems:

      • Check for secondary structures or repetitive elements near the target site

      • Analyze GC content and adjust homology arm design accordingly

      • Consider alternative target sites if persistent problems occur

Future Research Directions

  • What are the most promising future research directions for understanding nuoK function in Pseudomonas syringae pv. tomato?

    Promising research directions include:

    1. Structural Biology Approaches:

      • Cryo-EM determination of the complete NDH-1 complex structure in P. syringae

      • Molecular dynamics simulations of proton movement through NuoK transmembrane regions

      • Hydrogen-deuterium exchange studies to identify water-accessible channels

    2. Host-Pathogen Interaction Studies:

      • Investigation of how energy metabolism via NDH-1 contributes to virulence

      • Analysis of nuoK expression patterns during different infection stages

      • Evaluation of host defense responses targeting bacterial energy production

    3. Environmental Adaptation Analysis:

      • Comparative studies of nuoK function under different environmental stresses

      • Investigation of nuoK variants isolated from diverse ecological niches

      • Assessment of how NDH-1 efficiency impacts survival in planta

    4. Systems Biology Integration:

      • Multi-omics approaches connecting energy metabolism to virulence networks

      • Flux analysis of electron transport variations between pathogenic and non-pathogenic strains

      • Construction of genome-scale metabolic models incorporating nuoK function

  • How might advances in genome editing technologies enhance future studies of nuoK in Pseudomonas syringae pv. tomato?

    Emerging genome editing technologies offer new possibilities:

    1. CRISPR-Cas Systems Adapted for Pseudomonas:

      • Development of efficient CRISPR-Cas delivery methods for P. syringae

      • Implementation of base editing for precise nucleotide substitutions without double-strand breaks

      • Application of CRISPR interference (CRISPRi) for nuoK repression without genetic modification

    2. High-Throughput Mutagenesis:

      • Creation of comprehensive mutant libraries targeting entire nuoK sequence

      • Multiplex editing to simultaneously modify nuoK and interacting subunits

      • Deep mutational scanning to comprehensively map structure-function relationships

    3. In Situ Tagging:

      • Precise integration of fluorescent protein tags for live-cell imaging

      • Addition of affinity purification tags at endogenous loci

      • Development of split reporter systems to monitor protein-protein interactions in vivo

    4. Single-Cell Analysis Integration:

      • Combination of genome editing with single-cell transcriptomics

      • Analysis of population heterogeneity in nuoK expression and function

      • Correlation of single-cell phenotypes with specific genetic variants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.