Recombinant Pseudomonas syringae pv. tomato Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
kdpC; PSPTO_2244; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Target Names
kdpC
Target Protein Sequence
MSSVLRPALSLIVLMSLITGVAYPLVVTGVAQVAFPAQANGSLLYDEAGKVRGSALIAQS FTGDEWFQSRPSAGAFATVASGASNFAPSNPALATRVTEDAAKLANAAQGPVPLALLTTS GSGLDPHLSPEAIAWQAGRVAAARQLPLDKLQALIDASTQRPLIGPPVVNVLTLNMSLNQ LPSAPRNAQL
Uniprot No.

Target Background

Function
This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.
Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the Potassium-transporting ATPase C chain (kdpC) in Pseudomonas syringae pv. tomato DC3000?

The kdpC protein (locus tag PSPTO_2244) is a component of the potassium-transporting ATPase system in Pseudomonas syringae pv. tomato DC3000. It functions as the C subunit of the high-affinity K⁺ transport (Kdp) complex that plays a critical role in potassium homeostasis, particularly under conditions of potassium limitation. The gene is located on the chromosome at position 2485740-2486312 on the positive strand. The protein has a molecular weight of 19.5 kDa and an isoelectric point of 9.10, indicating its basic nature .

What are the key molecular properties of kdpC that researchers should consider?

When working with kdpC from Pseudomonas syringae pv. tomato DC3000, researchers should note several important molecular properties:

PropertyValueSignificance for Research
Molecular Weight19.5 kDaImportant for protein purification and gel electrophoresis analysis
Isoelectric Point (pI)9.10Determines buffer conditions for optimal protein stability
Charge at pH 71.22Affects protein-protein interactions and purification strategies
Kyte-Doolittle Hydrophobicity0.310Indicates moderate hydrophobicity, relevant for solubility predictions

These properties are crucial for designing expression systems, purification protocols, and experimental conditions .

How conserved is kdpC across Pseudomonas species?

The kdpC gene is highly conserved across Pseudomonas species. According to ortholog analysis, this gene belongs to the Pseudomonas Ortholog Group POG003739, which contains 509 members. It is classified as "Common," being found in both pathogenic and non-pathogenic strains, with hits to this gene identified in 250 genera. This high conservation suggests an essential role in bacterial physiology and makes it a suitable candidate for comparative studies across different Pseudomonas species .

How does kdpC function within the context of Pseudomonas syringae pathogenicity?

While kdpC primarily functions in potassium transport, its role in pathogenicity is complex and interconnected with other systems. Pseudomonas syringae pv. tomato relies on precise sensing of environmental signals for successful host infection. The bacterium utilizes chemoreceptors like PsPto-PscC to detect plant-derived compounds such as GABA and L-Pro, which drive bacterial entry into the tomato apoplast .

Though not directly implicated in this chemotactic response based on the available data, kdpC's role in maintaining potassium homeostasis likely contributes to bacterial fitness during infection. Potassium is an essential nutrient for bacterial growth and survival, and maintaining proper potassium levels is crucial during the transition from epiphytic to endophytic lifestyle that occurs during infection. Further research is needed to elucidate potential interactions between potassium transport systems and virulence mechanisms .

What are the challenges in expressing recombinant kdpC and how can they be addressed?

Expressing recombinant membrane-associated proteins like kdpC presents several challenges:

  • Membrane association: As a component of a membrane-bound ATPase complex, kdpC may have hydrophobic regions that complicate expression in soluble form.

  • Protein folding: The correct folding of kdpC may depend on interactions with other Kdp complex components (KdpA, KdpB).

  • Expression host selection: While E. coli is commonly used, a Pseudomonas-based expression system might better accommodate the codon usage and folding machinery needed for kdpC.

Methodological approaches to address these challenges include:

  • Using fusion tags (His6, MBP, GST) to improve solubility and facilitate purification

  • Co-expressing with other Kdp complex components

  • Optimizing growth conditions (temperature, induction timing, media composition)

  • Employing specialized expression strains designed for membrane proteins

How can structural studies of kdpC inform our understanding of potassium transport mechanisms?

Structural studies of kdpC can provide crucial insights into:

  • Subunit interactions: Determining how kdpC interacts with KdpA and KdpB to form a functional complex.

  • Conformational changes: Identifying structural changes that occur during the potassium transport cycle.

  • Regulatory mechanisms: Understanding how kdpC contributes to the regulation of potassium transport in response to environmental conditions.

Methodological approaches include:

  • X-ray crystallography of the isolated protein or the entire Kdp complex

  • Cryo-electron microscopy for visualizing the native complex architecture

  • Molecular dynamics simulations to study conformational changes

  • Site-directed mutagenesis to identify critical residues for function or interaction

What expression systems are most suitable for recombinant kdpC production?

The choice of expression system for recombinant kdpC depends on research objectives:

Expression SystemAdvantagesDisadvantagesBest Applications
E. coli pETHigh yield, easy manipulationMay not fold properlyInitial characterization, antibody production
E. coli with membrane protein tagsBetter folding for membrane proteinsLower yieldStructural studies
Pseudomonas-based systemsNative folding environmentMore complex to manipulateFunctional studies
Cell-free systemsAvoids toxicity issuesExpensive, lower yieldRapid screening, difficult-to-express variants

For functional studies, consider co-expressing with other Kdp complex components (KdpA, KdpB) to facilitate proper complex formation and stability.

How can the functional activity of recombinant kdpC be assessed in vitro?

Assessing kdpC functionality requires consideration of its role within the Kdp complex:

  • ATPase activity assays: While kdpC itself is not the ATPase component, its contribution to the ATPase activity of the complete complex can be measured using phosphate release assays with reconstituted complexes.

  • Potassium transport assays: Reconstituting the Kdp complex in liposomes and measuring K⁺ uptake using fluorescent indicators or radioactive tracers.

  • Protein-protein interaction studies: Using techniques like surface plasmon resonance (SPR), isothermal titration calorimetry (ITC), or pull-down assays to assess binding to other Kdp components.

  • Conformational change assays: Employing fluorescence resonance energy transfer (FRET) to detect conformational changes upon complex formation or substrate binding.

What purification strategies yield the highest purity recombinant kdpC for structural studies?

A multi-step purification strategy is recommended for obtaining high-purity kdpC:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using a His6-tag is effective for initial purification.

  • Intermediate purification: Ion exchange chromatography, leveraging kdpC's basic pI of 9.10 (use cation exchange at neutral pH).

  • Polishing step: Size exclusion chromatography to separate monomeric kdpC from aggregates and remove remaining impurities.

  • Detergent considerations: If purifying the membrane-associated form, select appropriate detergents (e.g., DDM, LMNG) to maintain native conformation without causing aggregation.

  • Quality control: Assess purity by SDS-PAGE, mass spectrometry, and dynamic light scattering; verify folding using circular dichroism.

How can researchers overcome low solubility issues when expressing recombinant kdpC?

Low solubility is a common challenge when working with membrane-associated proteins like kdpC. Consider these methodological approaches:

  • Fusion partners: MBP (maltose-binding protein) or SUMO tags can significantly enhance solubility.

  • Expression conditions: Lower induction temperature (16-20°C), reduced inducer concentration, and longer expression times often improve solubility.

  • Buffer optimization: Screen various buffers with different pH values (consider kdpC's pI of 9.10) and salt concentrations; include stabilizing agents like glycerol (10-20%).

  • Truncation constructs: Design constructs that exclude highly hydrophobic regions while retaining functional domains.

  • Solubilization agents: If membrane association is strong, mild detergents (0.1% DDM, 0.05% LMNG) may be necessary to maintain solubility without denaturing the protein.

What strategies can address protein degradation during recombinant kdpC purification?

Protein degradation during purification can significantly reduce yield and quality. Implement these methodological solutions:

  • Protease inhibitors: Include a comprehensive protease inhibitor cocktail throughout purification (PMSF, EDTA, leupeptin, aprotinin).

  • Temperature management: Maintain samples at 4°C throughout purification and minimize freeze-thaw cycles.

  • Buffer optimization: Include stabilizing agents (10% glycerol, 1mM DTT) and ensure appropriate pH (typically 7.5-8.0 for kdpC).

  • Rapid processing: Minimize time between purification steps; consider automated chromatography systems.

  • Protease-deficient expression strains: Use E. coli strains like BL21(DE3) pLysS that lack key proteases.

How can researchers validate that recombinant kdpC maintains its native conformation?

Confirming native conformation is essential for functional and structural studies:

  • Circular dichroism (CD) spectroscopy: Compare secondary structure elements with predicted values or with native protein if available.

  • Functional assays: Verify ability to form complexes with other Kdp components and contribute to ATPase activity.

  • Limited proteolysis: Properly folded proteins often show distinct proteolytic patterns compared to misfolded variants.

  • Thermal shift assays: Assess protein stability through melting temperature determination.

  • Binding studies: Confirm interaction with known binding partners using techniques like SPR or ITC.

How can recombinant kdpC be used to study Pseudomonas syringae pathogenicity mechanisms?

Recombinant kdpC can serve as a valuable tool for investigating pathogenicity:

  • Interaction studies: Identify potential interactions with plant defense proteins or other bacterial virulence factors.

  • Mutagenesis approaches: Create point mutations or domain swaps to investigate the relationship between potassium transport and virulence.

  • In planta expression: Express kdpC in plants to assess its impact on plant defense responses.

  • Vaccine development: Explore use as a potential component of bacterial vaccines for plant protection.

  • Diagnostic applications: Develop antibodies against kdpC for detecting Pseudomonas syringae in plant samples.

This protein could provide insights into how potassium homeostasis contributes to bacterial fitness during infection, complementing studies on chemotaxis systems like PsPto-PscC that directly sense plant-derived compounds such as GABA and L-Pro during infection .

What approaches can determine if kdpC interacts with components of bacterial chemotaxis systems?

Given that Pseudomonas syringae relies on chemotaxis for locating plant entry points , potential interactions between kdpC and chemotaxis components warrant investigation:

  • Co-immunoprecipitation: Using antibodies against kdpC to pull down potential interaction partners from bacterial lysates.

  • Bacterial two-hybrid systems: Testing direct protein-protein interactions in vivo.

  • Crosslinking mass spectrometry: Identifying proteins in close proximity to kdpC within intact cells.

  • Fluorescence microscopy: Utilizing fluorescently tagged kdpC to visualize co-localization with chemotaxis components.

  • Genetic approaches: Creating knockout strains of kdpC to assess impact on chemotactic responses toward plant-derived compounds like GABA and L-Pro.

What are the most promising future research directions for recombinant kdpC studies?

Future research on recombinant kdpC from Pseudomonas syringae pv. tomato should focus on:

  • Structure-function relationships: Determining high-resolution structures of kdpC alone and in complex with other Kdp components.

  • Role in pathogenicity: Exploring connections between potassium transport, bacterial fitness, and virulence using knockout mutants and complementation studies.

  • Potential as antimicrobial target: Investigating whether disruption of kdpC function could reduce bacterial fitness during infection.

  • Integration with other signaling systems: Examining potential crosstalk between potassium sensing/transport and chemotaxis pathways, particularly in the context of the PsPto-PscC chemoreceptor that mediates perception of plant-derived compounds .

  • Comparative studies: Analyzing functional differences in kdpC between pathogenic and non-pathogenic Pseudomonas strains to identify adaptations specific to the pathogenic lifestyle.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.