Recombinant Pseudomonas syringae pv. tomato Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for customer use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: Tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
ubiB; PSPTO_5152; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-539
Protein Length
full length protein
Species
Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Target Names
ubiB
Target Protein Sequence
MKLLAVRRLFRIQRVVIRYRLDDLLFALPLPWWMLAVRFVLPWRWLPRRKSELSRGVRFR LALQDLGPIFIKFGQLLSTRRDLLPEDIADELMLLQDRVPPFDQQVAIKLIEEQLGARIC DVFSRFDETPLASASVAQVHAACLKTGEEVVVKVVRPGLKPIIGQDLAWLFILARMAERV SADARLLHPVQVVMDYEKTIYDELDLLREAANSSQLRRNFEGSDLLYVPQVYWDWCRPKV LVMERIYGLQVTDMAGLADQRTDMKMLAERGVEIFFTQIFRDSFFHADMHPGNIFVSTVN PWAPKYIAIDCGIVGSLTPEDQDYLARNLFAFFKRDYRRVAQLHIDSGWVPAETKLNEFE AAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQPQLVLLQKTLLNIEGLGRQLY PELDLWSTAQPYLERWMRERVSPKTLLGNLQSQVEQLPHIAGMTRDLLERMSRPHASDPP RPWHDRKDEPVLRLIGAALLVGGAIQGWVMSEAATQLLTLTAWPAAIMLIAGLYLIVRR
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, involved in the aerobic biosynthesis of coenzyme Q (ubiquinone).
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of ubiB in Pseudomonas syringae pv. tomato?

The ubiB gene in Pseudomonas syringae pv. tomato (strain DC3000) is identified by the ordered locus name PSPTO_5152 and encodes the probable ubiquinone biosynthesis protein UbiB. This gene is part of the core genome that participates in essential metabolic functions. The protein consists of 539 amino acids and is part of the UbiB protein family, which is involved in aerobic ubiquinone biosynthesis . In Pseudomonas syringae pv. tomato DC3000, ubiB exists within a conserved gene neighborhood that is typical of ubiquinone biosynthetic pathway genes, though specific gene arrangements may differ from those in other bacterial species.

How is UbiB protein structurally characterized?

The UbiB protein in Pseudomonas syringae pv. tomato (strain DC3000) has 539 amino acids with a complex secondary structure. According to the amino acid sequence data, it contains multiple transmembrane domains and conserved motifs typical of the UbiB family proteins . The protein sequence includes regions associated with ATP binding, which is consistent with its proposed role in energy-dependent steps of ubiquinone biosynthesis. While the complete three-dimensional structure has not been fully resolved, sequence analysis indicates that it shares structural features with other members of the UbiB family, including those in the COQ8 subfamily found in other organisms . These proteins typically contain a kinase-like fold despite many being classified as pseudokinases that may perform non-canonical functions.

What is the functional role of UbiB in ubiquinone biosynthesis?

UbiB plays a critical role in ubiquinone (coenzyme Q) biosynthesis, which is essential for cellular respiration and energy production. While the exact biochemical function of UbiB remains incompletely characterized, it is believed to facilitate one or more key steps in the ubiquinone biosynthetic pathway. UbiB belongs to a family of proteins that includes the COQ8 proteins in other organisms, which are required for coenzyme Q biosynthesis . Research on homologous proteins indicates that UbiB may function as a pseudokinase, potentially regulating protein-protein interactions or serving as a scaffold for other biosynthetic enzymes rather than directly catalyzing a reaction in the pathway. The importance of UbiB is underscored by research on related proteins showing that inhibition of COQ8 affects ubiquinone biosynthesis, which has implications for cellular metabolism and potentially for pathogenesis .

What is the evolutionary relationship between ubiB in P. syringae and similar genes in other bacterial species?

The ubiB gene shows significant conservation across diverse bacterial species, indicating its evolutionary importance. Comparative genomic analyses reveal that UbiB belongs to a broader family of proteins involved in ubiquinone biosynthesis, including COQ8 variants in other organisms . Within the Pseudomonas genus, the gene shows high sequence similarity, particularly among pathovars of P. syringae. Multilocus sequence typing (MLST) studies of P. syringae pv. tomato have shown that recombination plays a significant role in the evolution of these bacteria, contributing more than mutations to genetic variation between isolates . This suggests that genes like ubiB may have been subject to horizontal gene transfer events during the evolutionary history of P. syringae. The conservation of this gene across different pathovars suggests its critical function in bacterial metabolism, regardless of host specialization.

What expression systems are most effective for producing recombinant UbiB protein?

For optimal expression of recombinant UbiB protein from Pseudomonas syringae pv. tomato, several expression systems have been evaluated with varying degrees of success. E. coli-based expression systems remain the most widely used due to their efficiency and scalability. For the expression of membrane-associated proteins like UbiB, specialized E. coli strains such as C41(DE3) or C43(DE3) designed for membrane protein expression have shown superior results.

The following table summarizes key expression strategies:

Expression SystemAdvantagesLimitationsTag Recommendations
E. coli BL21(DE3)High yield, economicalInclusion body formationN-terminal His6 tag
E. coli C41/C43(DE3)Better for membrane proteinsModerate yieldC-terminal His6-SUMO tag
Pseudomonas-basedNative folding environmentComplex cultivationNative or FLAG tag
Cell-free systemsAvoids toxicity issuesExpensive, lower yieldHis6 or GST tag

When expressing UbiB, temperature optimization is critical, with induction at lower temperatures (16-18°C) significantly improving soluble protein yield. The tag type should be determined during the production process to optimize for protein function and solubility . Purification typically involves buffer systems containing 50% glycerol with Tris-based buffers to maintain stability, with recommended storage at -20°C or -80°C for extended periods to prevent protein degradation .

How can recombineering techniques be applied to study UbiB function in P. syringae?

Recombineering offers powerful tools for precise genomic manipulation to study UbiB function in Pseudomonas syringae. The identification of RecT and RecE homologs in P. syringae pv. syringae B728a has enabled efficient recombination between genomic loci and linear DNA substrates introduced by electroporation . This system can be applied to ubiB research in several ways:

For targeted gene disruption, the RecTE recombineering system has proven highly effective. The process involves:

  • Construction of a RecTE expression vector (such as pUCP24/47) containing the P. syringae recT and recE genes under an inducible promoter

  • Introduction of linear DNA fragments containing homology regions flanking ubiB

  • Selection for recombinants using appropriate markers

  • Elimination of the RecTE expression vector using the sacB counterselection system

The efficiency of recombination can be enhanced by using longer homology arms (>40 bp) and optimizing electroporation conditions. For single nucleotide mutations in ubiB, single-stranded DNA oligonucleotides can be used with expression of RecT alone, as this protein is sufficient to promote recombination of ssDNA . This approach allows for precise point mutations to study structure-function relationships in the UbiB protein without disrupting the entire gene.

What analytical methods are most appropriate for assessing UbiB protein function and activity?

Multiple analytical approaches can be employed to thoroughly assess UbiB protein function and activity:

Biochemical Assays:

  • ATP binding and hydrolysis assays to evaluate potential kinase-like activity

  • Ubiquinone quantification using HPLC or LC-MS/MS to measure pathway output

  • Protein-protein interaction studies using pull-down assays, co-immunoprecipitation, or yeast two-hybrid systems to identify binding partners

Structural Analyses:

  • Circular dichroism (CD) spectroscopy to assess secondary structure

  • Nuclear magnetic resonance (NMR) or X-ray crystallography for detailed structural information

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe conformational dynamics

Functional Genomics:

  • Complementation assays in ubiB deletion mutants to verify function

  • Transcriptomic analysis to identify genes co-regulated with ubiB

  • Metabolomic profiling to characterize changes in ubiquinone precursors and related metabolites

The integration of these methods provides comprehensive insights into UbiB function. When studying potential pseudokinase activity, it's important to note that even catalytically inactive kinase-like proteins can perform critical regulatory functions through their inactive ATP binding domains, as seen with COQ8 proteins .

What is the relationship between UbiB and COQ8 proteins in the context of ubiquinone biosynthesis?

UbiB from Pseudomonas syringae pv. tomato and COQ8 proteins found in other organisms belong to the same protein family and share functional similarities despite sequence divergence. COQ8 proteins (including COQ8A and COQ8B in humans) are required for coenzyme Q biosynthesis, similar to the proposed role of UbiB .

The relationship between these proteins is characterized by:

  • Evolutionary Conservation: UbiB and COQ8 proteins represent evolutionarily related members of the UbiB protein family that have specialized in different organisms while maintaining similar core functions.

  • Functional Parallels: Despite sequence differences, both protein types are essential for ubiquinone biosynthesis. The recent development of potent COQ8 inhibitors like TTP-UNC-CA157 has provided valuable tools for studying these proteins' functions .

  • Structural Similarities: Both UbiB and COQ8 proteins contain kinase-like domains, though many function as pseudokinases. This suggests they may act through protein-protein interactions rather than direct catalytic activity.

  • Differences in Regulatory Context: While sharing core functions, these proteins operate within different regulatory networks specific to their host organisms. In P. syringae, UbiB function may be integrated with pathogenesis-related metabolic shifts.

Understanding the comparative biology of UbiB and COQ8 proteins can provide insights into the fundamental mechanisms of ubiquinone biosynthesis across different biological systems. Research using specific inhibitors developed for one family member may potentially be applicable to studying related proteins, offering new approaches to investigate UbiB function in P. syringae .

What are the optimal conditions for preserving recombinant UbiB protein stability?

Maintaining the stability of recombinant UbiB protein from Pseudomonas syringae pv. tomato requires careful attention to storage conditions and buffer composition. Based on experimental data, the following recommendations can be made:

Storage Buffer Composition:

  • Tris-based buffer systems with pH 7.5-8.0 provide optimal stability

  • Addition of 50% glycerol is critical for preventing protein aggregation and denaturation

  • Low concentrations of reducing agents (1-2 mM DTT or β-mercaptoethanol) help maintain cysteine residues in their reduced state

  • For membrane-associated UbiB preparations, inclusion of mild detergents (0.01-0.05% DDM or CHAPS) may improve stability

Temperature Considerations:

  • For short-term storage (up to one week), 4°C is acceptable for working aliquots

  • For medium-term storage, -20°C is recommended

  • For extended storage periods, -80°C provides the best stability

Handling Recommendations:

  • Avoid repeated freeze-thaw cycles as they significantly accelerate protein degradation

  • Prepare small working aliquots to minimize freeze-thaw events

  • When thawing, do so rapidly in a room temperature water bath, then immediately transfer to ice

  • Consider adding protease inhibitors for additional stability during experimental manipulations

Following these guidelines can significantly extend the functional lifetime of recombinant UbiB preparations and ensure consistent experimental results across multiple studies.

How can researchers effectively study UbiB's role in bacterial adaptation to host environments?

To effectively investigate UbiB's role in P. syringae adaptation to host environments, researchers should employ a multifaceted approach that integrates molecular genetics, evolutionary analyses, and host-pathogen interaction studies:

Comparative Genomics Approach:

  • Analyze ubiB sequences across multiple P. syringae isolates from different hosts to identify potential adaptive mutations

  • Apply multilocus sequence typing (MLST) methodologies similar to those used in evolutionary studies of P. syringae

  • Determine if recombination events have affected the ubiB locus, as recombination has been shown to contribute significantly to P. syringae evolution

Functional Validation Techniques:

  • Generate targeted ubiB mutants using recombineering methods with the RecTE system from P. syringae

  • Perform complementation studies with ubiB variants from strains adapted to different host plants

  • Conduct competition assays between wild-type and ubiB-modified strains during host colonization

Host Interaction Studies:

  • Compare bacterial growth curves in different plant hosts for wild-type and ubiB variant strains

  • Assess the impact of plant defense responses on bacteria with different ubiB alleles

  • Investigate whether ubiB expression changes in response to host-derived signals or stress conditions

This research framework allows for comprehensive evaluation of how UbiB may contribute to host adaptation, building on established knowledge that P. syringae strains show evidence of ongoing adaptation to their hosts, with genes important for virulence and metabolism under selection pressure . The approach also leverages the finding that P. syringae pv. tomato strain DC3000 belongs to a phylogenetic cluster with a relatively wide host range, suggesting metabolic flexibility that may involve proteins like UbiB .

What strategies can resolve contradictions in published data regarding UbiB function?

Resolving contradictions in published data regarding UbiB function requires systematic approaches that address potential sources of variability and experimental limitations:

Standardization of Experimental Systems:

  • Develop consensus protocols for protein expression and purification to ensure comparable starting materials

  • Establish reference strains and construct repositories for validated mutants to enable direct comparison between studies

  • Create standardized assay conditions for measuring UbiB-related biochemical activities

Meta-analysis Approach:

  • Conduct comprehensive literature reviews with formalized evaluation criteria for study quality

  • Perform statistical meta-analyses of published results where methodologies are sufficiently similar

  • Identify patterns in contradictory results that might reveal context-dependent functions

Integrative Experimental Design:

  • Design experiments that directly test competing hypotheses about UbiB function

  • Employ multiple complementary techniques to overcome limitations of individual methods

  • Utilize systems biology approaches to place UbiB within broader metabolic and regulatory networks

Collaborative Research Initiatives:

  • Establish consortia of laboratories to simultaneously test the same hypotheses using standardized materials

  • Implement round-robin testing of key findings to verify reproducibility across different research environments

  • Develop open data repositories for sharing raw experimental results to facilitate reanalysis and integration

By systematically addressing potential sources of contradiction using these approaches, researchers can develop a more coherent understanding of UbiB function. This is particularly important given that UbiB belongs to a protein family that includes pseudokinases that may perform non-canonical functions through their inactive ATP binding domains , making functional characterization particularly challenging.

What are the most promising approaches for developing targeted inhibitors of UbiB function?

Developing targeted inhibitors for UbiB in Pseudomonas syringae pv. tomato could advance both fundamental research and potential agricultural applications. Several promising approaches warrant investigation:

Structure-Based Drug Design:
Building on recent successes with COQ8 inhibitors like TTP-UNC-CA157 , researchers can:

  • Generate structural models of UbiB based on homology with solved structures of related proteins

  • Perform virtual screening campaigns targeting predicted ATP-binding pockets

  • Optimize lead compounds through iterative structure-activity relationship studies

Mechanism-Based Inhibitor Development:

  • Design ATP-competitive inhibitors that exploit the kinase-like fold of UbiB

  • Develop covalent inhibitors targeting conserved cysteine residues unique to UbiB family proteins

  • Create allosteric inhibitors that stabilize inactive conformations of the protein

Biological Screening Approaches:

  • Establish high-throughput screening assays using bacterial growth in ubiquinone-dependent conditions

  • Implement phenotypic screens measuring ubiquinone levels in treated bacteria

  • Develop biosensor strains that report on ubiquinone biosynthetic pathway activity

The development of selective UbiB inhibitors would provide valuable chemical tools for dissecting protein function while potentially offering leads for novel antibacterial agents. The successful inhibition of COQ8 demonstrates the feasibility of targeting this protein family , suggesting similar approaches could be effective for UbiB.

How might UbiB function be integrated into systems biology models of P. syringae metabolism?

Integrating UbiB function into systems biology models of P. syringae metabolism requires a comprehensive approach that places ubiquinone biosynthesis within the broader context of bacterial physiology and host-pathogen interactions:

Metabolic Network Integration:

  • Incorporate ubiquinone biosynthesis pathways into existing genome-scale metabolic models of P. syringae

  • Define stoichiometric relationships between UbiB activity and related metabolic processes

  • Identify metabolic chokepoints where UbiB function influences multiple downstream pathways

Regulatory Network Analysis:

  • Characterize transcriptional and post-translational regulation of ubiB expression

  • Map interactions between ubiquinone metabolism and virulence factor regulation

  • Develop dynamic models that capture temporal changes in UbiB activity during infection

Multi-omics Data Integration:

  • Incorporate transcriptomic, proteomic, and metabolomic datasets to refine model parameters

  • Validate model predictions using targeted experimental interventions

  • Apply machine learning approaches to identify non-obvious relationships between UbiB function and other cellular processes

Host-Pathogen Interface Modeling:

  • Extend models to include host metabolic responses to infection

  • Simulate the impact of plant defense mechanisms on bacterial ubiquinone metabolism

  • Model energetic requirements during different phases of plant colonization

These approaches can leverage existing knowledge about P. syringae evolution and host adaptation , while providing a framework for predicting how perturbations to UbiB function might affect bacterial fitness in different environments. Such models would be particularly valuable for understanding how metabolic adaptations contribute to the unusual host range of strains like PtoDC3000, which can infect multiple plant families .

What are the key unresolved questions regarding UbiB function in P. syringae?

Despite advances in our understanding of UbiB in Pseudomonas syringae pv. tomato, several critical questions remain unresolved:

  • Precise Biochemical Function: While UbiB is associated with ubiquinone biosynthesis, its exact biochemical role—whether as an enzyme, scaffold protein, or regulator—remains incompletely defined.

  • Structure-Function Relationships: The specific structural features that determine UbiB's function and how they compare to homologous proteins in other organisms need further characterization.

  • Regulatory Mechanisms: How UbiB expression and activity are regulated in response to environmental conditions, particularly during host infection, is poorly understood.

  • Evolutionary Significance: The contribution of UbiB to the evolutionary adaptation of P. syringae to different host plants requires further investigation, particularly in light of evidence that recombination has played a significant role in P. syringae evolution .

  • Potential as a Therapeutic Target: The feasibility of targeting UbiB for the development of new agricultural control strategies against bacterial speck disease needs evaluation.

  • Integration with Virulence Mechanisms: The relationship between ubiquinone biosynthesis and established virulence factors like the type III secretion system remains to be fully elucidated.

Addressing these questions will require integrated approaches combining structural biology, genetics, biochemistry, and host-pathogen interaction studies. The development of specific research tools, such as selective UbiB inhibitors similar to those created for COQ8 , will be essential for advancing our understanding of this important protein.

How might advances in UbiB research contribute to broader plant pathology and bacterial metabolism understanding?

Advances in UbiB research have the potential to make significant contributions to multiple fields:

In plant pathology, deeper understanding of UbiB could reveal new insights into:

  • The metabolic adaptations that enable P. syringae to colonize diverse host plants

  • The energy requirements of virulence factor deployment during infection

  • Potential targets for novel disease management strategies that disrupt bacterial metabolism rather than directly targeting virulence factors

For bacterial metabolism studies, UbiB research may:

  • Clarify fundamental aspects of ubiquinone biosynthesis that apply across bacterial species

  • Reveal new mechanisms by which pseudokinases contribute to metabolic regulation

  • Provide a model for understanding how core metabolic processes adapt during host-pathogen coevolution

The significance of this research extends beyond P. syringae, as insights may be applicable to other plant pathogens and potentially to human pathogens as well. Comparative studies between UbiB and related proteins like COQ8 could bridge plant and human pathology research, particularly given that mutations in COQ8 genes are linked to human diseases .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.