Recombinant Pseudomonas syringae pv. tomato Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pseudomonas syringae pv. tomato Prolipoprotein Diacylglyceryl Transferase (Lgt)

Recombinant Pseudomonas syringae pv. tomato prolipoprotein diacylglyceryl transferase (Lgt) is a bacterial enzyme critical for post-translational modification of lipoproteins. Lgt catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of a conserved cysteine residue in prolipoproteins, forming a thioether bond essential for membrane anchoring and lipoprotein maturation . This enzyme is encoded by the lgt gene (locus tag PSPTO_5283) in P. syringae pv. tomato DC3000, a model phytopathogen .

Gene and Protein Features

PropertyValue
Gene locusPSPTO_5283 (chromosome)
Protein nameProlipoprotein diacylglyceryl transferase
Molecular weight30.1 kDa
Isoelectric point (pI)9.97
Charge (pH 7)+7.70
Hydrophobicity (Kyte-Doolittle)0.583

The lgt gene spans nucleotides 6,007,992–6,008,804 on the reverse strand of the DC3000 chromosome . Its product is a membrane-bound enzyme conserved across Gram-negative bacteria, though absent in some Gram-positive species .

Biochemical Function and Mechanism

Lgt mediates the first step of lipoprotein maturation:

  1. Substrate recognition: Binds phosphatidylglycerol and prolipoproteins via conserved motifs .

  2. Diacylglyceryl transfer: Transfers the sn-1,2-diacylglyceryl moiety to cysteine +1 of the prolipoprotein .

  3. Byproduct release: Generates glycerolphosphate as a byproduct .

This modification enables subsequent processing by signal peptidase II (Lsp) and apolipoprotein N-acyltransferase (Lnt) to form triacylated lipoproteins .

Essentiality and Mutational Analysis

  • Essential gene: lgt depletion in E. coli causes growth arrest, suggesting similar essentiality in P. syringae .

  • Complementation assays: Alanine substitution at D129 abolishes enzyme activity, while cysteine mutants retain partial function .

Role in Pathogenesis

  • Virulence factor: Lipoproteins modified by Lgt contribute to bacterial adhesion, nutrient uptake, and evasion of plant immune responses .

  • Host adaptation: DC3000 lipoproteins may explain its atypical broad host range (tomato, Arabidopsis, cauliflower) .

Applications and Implications

  1. Antimicrobial targets: Lgt’s essentiality makes it a candidate for novel antibiotics targeting lipid metabolism .

  2. Biotechnological tool: Recombinant Lgt enables controlled lipoprotein engineering for vaccine development .

  3. Plant-pathogen studies: DC3000’s Lgt variants help dissect host-specific virulence mechanisms .

Comparative Genomics and Evolution

  • Conservation: Lgt homologs exist in all Pseudomonas pathovars but show sequence divergence in substrate-binding regions .

  • Horizontal gene transfer: The lgt locus exhibits phylogenetic clustering with Brassicaceae-adapted P. syringae strains, suggesting adaptive evolution .

Future Research Directions

  • Structural studies: Cryo-EM or crystallography to resolve Lgt’s substrate-binding pocket .

  • Host interaction screens: Identify plant receptors recognizing Lgt-modified lipoproteins .

  • Inhibitor development: High-throughput screening for Lgt-specific small molecules .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please let us know, and we will prioritize its inclusion in the manufacturing process.
Synonyms
lgt; PSPTO_5283; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Target Names
lgt
Target Protein Sequence
MLPYPQIDPVAVAIGPLQIHWYGLMYLVGIGGAWLLASRRLNKFDPTWTKEKLSDLIFWL AMGVIVGGRLGYVLFYDLSAYIANPLLIFEVWKGGMAFHGGFVGVMIAAWWFGKRNGKSF FQLMDFVAPLVPIGLGAGRIGNFINAELWGKPTDVPWAMVFPPFSDPAQLARHPSQLYQF ALEGVALFIILNLYARKPRPTMAVSGMFALFYGIFRFVVEFVRVPDAQLGYLAWGWVTMG QILSLPMIIAGLFLIWLAYKRDPAASKAAV
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) and what is its function in Pseudomonas syringae pv. tomato?

Prolipoprotein diacylglyceryl transferase (lgt) is an enzyme encoded by the gene lgt (PSPTO_5283) in Pseudomonas syringae pv. tomato strain DC3000. It catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein . This reaction represents the first step in bacterial lipoprotein biosynthesis, which is critical for bacterial membrane integrity and function.

The enzyme has the EC number 2.4.99.- and is characterized by its role in post-translational modification of proteins destined for the bacterial membrane. The full amino acid sequence of the lgt protein from P. syringae pv. tomato strain DC3000 consists of 270 amino acids as documented in UniProt (Q87μL3) .

How is lgt structurally characterized and what domains are present in the protein?

The recombinant lgt protein from Pseudomonas syringae pv. tomato has a specific structure dominated by transmembrane regions, which is consistent with its role in membrane-associated processes. Analysis of the amino acid sequence reveals:

  • The full protein consists of 270 amino acids

  • Contains multiple hydrophobic regions typical of membrane-associated proteins

  • The amino acid sequence (mLPYPQIDPVAVAIGPLQIHWYGLMYLVGIGGAWLLASRRLNKFDPTWTKEKLSDLIFWLAMGVIVGGRLGYVLFYDLSAYIANPLLIFEVWKGGMAFHGGFVGVMIAAWWFGKRNGKSFFQLMDFVAPLVPIGLGAGRIGNFINAELWGKPTDVPWAMVFPPFSDPAQLARHPSQLYQFALEGVALFIILNLYARKPRPTMAVSGMFALFYGIFRFVVEFVRVPDAQLGYLAWGWVTMGQILSLPMIIAGLFLIWLAYKRDPAASKAAV) includes multiple predicted transmembrane helices

What is the genomic context of the lgt gene in P. syringae pv. tomato?

The lgt gene in P. syringae pv. tomato strain DC3000 is identified as PSPTO_5283 . Understanding the genomic context provides insights into potential co-regulated genes or functional relationships. While the search results don't provide the complete genomic context, researchers should examine:

  • Adjacent genes that may be part of the same operon

  • Regulatory elements in the promoter region

  • Comparative genomic analysis with lgt genes from other Pseudomonas species or related bacteria

How does lgt potentially contribute to the virulence of P. syringae pv. tomato in plant hosts?

While the search results don't directly link lgt to virulence in P. syringae pv. tomato, we can draw insights from related virulence mechanisms. P. syringae pv. tomato strain DC3000 is known to induce systemic susceptibility in host plants like Arabidopsis thaliana . Since lgt is involved in bacterial lipoprotein biosynthesis, it may contribute to virulence through several mechanisms:

  • Maintenance of membrane integrity necessary for survival in the plant environment

  • Potential involvement in the processing or localization of other virulence factors

  • Possible role in the modulation of pathogen-associated molecular patterns (PAMPs) that can trigger plant immune responses

Research has identified other virulence regulators in P. syringae pv. tomato strain DC3000, such as TvrR, a member of the TetR family of transcriptional regulators necessary for virulence . While TvrR and lgt are distinct proteins, they may be part of interconnected virulence networks.

What are the most effective methods for expressing and purifying functional recombinant lgt protein?

Successful expression and purification of functional recombinant lgt require careful consideration of expression systems and purification methods. Based on available information:

Expression Systems:

  • E. coli expression systems have been successfully used to produce recombinant lgt

  • The protein may be expressed with appropriate tags to facilitate purification

Purification Considerations:

  • As a membrane-associated protein, lgt requires specific solubilization methods

  • Use of detergents or membrane-mimicking systems may be necessary to maintain function

  • Storage in glycerol-containing buffers (50% glycerol in Tris-based buffer) helps preserve stability

Storage Recommendations:

  • Store at -20°C for short-term storage

  • Use -80°C for extended storage

  • Avoid repeated freeze-thaw cycles, which can compromise protein integrity

How can researchers distinguish between structural and functional roles of lgt in bacterial physiology?

This question requires a multifaceted experimental approach:

  • Structure-function analysis:

    • Site-directed mutagenesis targeting catalytic residues

    • Chimeric protein construction to identify domain-specific functions

    • In vitro enzymatic assays with purified protein variants

  • Complementation studies:

    • Construction of lgt knockout mutants

    • Complementation with wild-type and mutant versions of lgt

    • Phenotypic assessment of membrane integrity, stress response, and virulence

  • Interactome analysis:

    • Identification of protein-protein interactions using techniques like pull-down assays or bacterial two-hybrid systems

    • Characterization of substrate specificity using proteomics approaches

What approaches can be used to investigate the regulation of lgt expression in P. syringae pv. tomato?

Understanding the regulation of lgt expression requires multiple experimental approaches:

  • Promoter analysis:

    • Identification of regulatory elements in the lgt promoter

    • Construction of reporter fusions (e.g., lgt promoter-GFP)

    • Assessment of promoter activity under different conditions

  • Transcriptional regulation:

    • Evaluation of expression patterns using qRT-PCR

    • Identification of transcription factors that bind to the lgt promoter

    • Analysis of the role of sigma factors in lgt expression

  • Environmental influences:

    • Assessment of lgt expression in planta versus in vitro

    • Examination of expression patterns under various stress conditions

    • Evaluation of expression during different stages of plant infection

While the search results don't provide specific information about lgt regulation, insights can be drawn from the regulation of other virulence-associated genes in P. syringae. For example, TvrR, a TetR-like regulator, negatively regulates its own expression, which is a common characteristic of TetR family regulators .

How can PMA-qPCR methodology be optimized for studying viable P. syringae pv. tomato cells expressing lgt?

The propidium monoazide-quantitative PCR (PMA-qPCR) methodology has been successfully used for the quantification of viable P. syringae pv. tomato cells in tomato seed . This technique can be adapted for studying lgt expression in viable cells:

Optimization of PMA Treatment Parameters:

ParameterOptimal ConditionNotes
PMA Concentration10 μmol liter^-1Selectively binds to DNA of dead cells
Light Exposure Time10 minutesUsing 50-W LED lamp at 15 cm distance
Incubation Conditions20 min at room temperature in darkAllows PMA to penetrate dead cells
DNA Extraction MethodTIANamp Bacteria DNA Kit or equivalentEnsures high-quality DNA for qPCR

Primer Design for lgt-Specific Detection:

  • Design primers specific to the lgt gene (PSPTO_5283)

  • Ensure specificity by testing against related bacterial species

  • Optimize qPCR conditions for maximum sensitivity and specificity

Detection Limits:

  • The PMA-qPCR method can detect as few as 10^2 CFU ml^-1 in bacterial suspensions

  • In seed samples, detection limits of approximately 11.86 CFU g^-1 are achievable

This approach allows researchers to specifically quantify viable P. syringae pv. tomato cells expressing lgt, avoiding false positives from dead cells that may still contain intact DNA.

What are the comparative advantages of different detection methods for studying lgt expression and function?

Researchers have multiple options for detecting and quantifying P. syringae pv. tomato and studying lgt expression:

MethodAdvantagesLimitationsSensitivity
Traditional Plating- Detects only viable cells
- Simple equipment needs
- Direct quantification
- Time-consuming (days)
- Labor-intensive
- May miss viable but non-culturable cells
10^2-10^3 CFU ml^-1
Conventional PCR- Rapid detection
- High specificity
- Well-established protocols
- Cannot distinguish viable from dead cells
- Limited quantification
10^3-10^4 CFU ml^-1
qPCR- Quantitative results
- High sensitivity
- Rapid turnaround
- Cannot distinguish viable from dead cells
- Requires specialized equipment
10^2 CFU ml^-1
PMA-qPCR- Selectively detects viable cells
- High sensitivity
- Quantitative results
- More complex protocol
- Additional reagent costs
- Optimization required
10^2 CFU ml^-1 in suspension
11.86 CFU g^-1 in seed
Immunological Methods- Protein-level detection
- Can detect non-culturable cells
- Variable specificity
- Antibody production required
- Less quantitative
Variable

For studying lgt specifically, researchers should consider developing:

  • lgt-specific primers for PCR/qPCR-based detection

  • Antibodies against lgt for immunological detection

  • Reporter gene fusions for monitoring lgt expression in vivo

How can researchers address challenges in expressing and studying membrane-associated proteins like lgt?

Membrane proteins like lgt present specific challenges for expression, purification, and functional studies:

  • Expression optimization:

    • Use of specialized E. coli strains designed for membrane protein expression

    • Careful selection of detergents for solubilization

    • Consideration of fusion tags that enhance solubility

    • Temperature optimization during induction

  • Purification strategies:

    • Use of affinity chromatography with carefully selected detergents

    • Implementation of size exclusion chromatography to ensure homogeneity

    • Validation of protein folding and stability after purification

  • Functional characterization:

    • Development of in vitro assays that mimic the membrane environment

    • Use of liposomes or nanodiscs to study enzyme activity

    • Implementation of biophysical techniques to assess protein-lipid interactions

  • Storage considerations:

    • Use of 50% glycerol in Tris-based buffer as recommended

    • Storage at -20°C for short-term or -80°C for long-term preservation

    • Preparation of working aliquots to avoid repeated freeze-thaw cycles

How should discrepancies between in vitro enzymatic activity and in planta virulence phenotypes be interpreted?

Researchers often encounter situations where in vitro biochemical results don't perfectly align with in planta observations. When studying lgt, consider:

  • Contextual differences:

    • In vitro conditions often use purified components that may not reflect the complexity of the in planta environment

    • The plant apoplast provides a unique biochemical environment that may affect enzyme activity

  • Redundancy in biological systems:

    • Multiple bacterial enzymes may have overlapping functions

    • Compensatory mechanisms may mask phenotypes in single-gene mutants

  • Temporal and spatial considerations:

    • Expression timing during infection matters

    • Localization of the protein within bacterial cells or tissues

  • Methodological approach:

    • Employ multiple complementary techniques

    • Design controls that address specific aspects of the discrepancy

    • Use genetic approaches (knockouts, complementation) alongside biochemical assays

What statistical considerations are important when analyzing lgt expression data across different experimental conditions?

When analyzing expression data for lgt:

  • Experimental design considerations:

    • Use appropriate biological and technical replicates (minimum three biological replicates)

    • Include proper controls for normalization

    • Account for batch effects in multi-day experiments

  • Statistical analysis approaches:

    • For qPCR data: Use ΔΔCt method with appropriate reference genes

    • For differential expression: Apply ANOVA or t-tests with multiple testing correction

    • For complex experimental designs: Consider linear mixed models

  • Validation strategies:

    • Confirm key findings with alternative methods

    • Use protein-level measurements to validate transcriptional changes

    • Perform in planta confirmation of in vitro findings

The methodological rigor established for PMA-qPCR optimization can serve as a model for experimental design in lgt studies, where each condition was tested in triplicate to ensure reproducibility .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.