Recombinant Pseudomonas syringae pv. tomato UPF0060 membrane protein PSPTO_1628 (PSPTO_1628)

What is PSPTO_1628 and what are its basic structural characteristics?

PSPTO_1628 is a UPF0060 family membrane protein found in Pseudomonas syringae pv. tomato strain DC3000, a bacterial plant pathogen that causes bacterial speck disease in tomato plants. The protein consists of 110 amino acids and is characterized by its hydrophobic transmembrane domains. The amino acid sequence (MLNYLWFFLAALFEIAGCYAFWLWLRQGKSALWVIPALISLTLFALLLTRVEAAYAGRAY AAYGGIYIVASIAWLGLVERVRPLGTDWLGLAFCVIGATIILLGPRWSAP) suggests it is an integral membrane protein with multiple hydrophobic segments that likely span the bacterial inner membrane . Structural prediction analyses indicate it shares homology with YnfA of E. coli, another membrane protein with poorly characterized function .

What is currently known about the function of PSPTO_1628 in Pseudomonas syringae?

Current research suggests that PSPTO_1628 may be involved in membrane integrity or transport processes, though its precise function remains largely uncharacterized. Studies indicate it might be part of the same mRNA transcript as csrA1, suggesting potential co-regulation with this post-transcriptional regulator . Given its membrane localization, PSPTO_1628 could potentially play a role in processes related to bacterial adaptation to plant hosts, stress response, or virulence, but targeted functional studies are still needed to confirm these hypotheses. The UPF0060 family designation indicates it belongs to a group of uncharacterized protein families with conserved sequences but unknown functions.

How does the genetic context of PSPTO_1628 inform our understanding of its possible function?

Genomic analyses reveal that PSPTO_1628 appears to be co-transcribed with csrA1, suggesting it may be functionally linked to post-transcriptional regulatory networks in P. syringae . This is particularly significant since CsrA proteins regulate various virulence traits in P. syringae pv. tomato DC3000, including motility, exopolysaccharide production, siderophore synthesis, and type III secretion system assembly . The genetic proximity to csrA1 indicates PSPTO_1628 might be involved in similar regulatory pathways affecting bacterial virulence and host adaptation. Comparative genomic approaches examining the conservation and synteny of this locus across different Pseudomonas strains could provide additional insights into its evolutionary significance and functional importance.

What expression systems are most effective for producing recombinant PSPTO_1628?

For PSPTO_1628 expression, E. coli-based systems have proven effective, particularly when fused to tags that enhance solubility and facilitate purification . The documented successful expression approach includes:

• Vector selection: Vectors containing strong, inducible promoters (e.g., T7 promoter systems)

• Fusion tags: N-terminal His-tag fusion has been successfully employed

• Expression conditions: Optimization of temperature (typically lowered to 18-25°C post-induction), inducer concentration, and expression duration to minimize inclusion body formation

• Host strains: E. coli strains optimized for membrane protein expression, such as C41(DE3) or C43(DE3) derivatives

For researchers seeking alternative expression systems, insect cell-based baculovirus expression vector systems (BEVS) could be considered, as they have demonstrated success with other challenging membrane proteins . This approach is particularly valuable when proper folding and post-translational modifications are critical for functional studies.

What are the key considerations for optimizing PSPTO_1628 membrane protein purification?

Purifying membrane proteins like PSPTO_1628 requires specific strategies to maintain protein stability and functionality:

• Membrane extraction: Use of appropriate detergents (common choices include n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin) at concentrations above their critical micelle concentration

• Purification protocol:

  • Cell lysis optimization (typically sonication or French press)

  • Membrane fraction isolation via ultracentrifugation

  • Solubilization in detergent buffer (4-8 hours at 4°C)

  • Affinity chromatography (Ni-NTA for His-tagged constructs)

  • Consider size exclusion chromatography as a polishing step

• Buffer optimization:

  • pH maintenance (typically 7.0-8.0)

  • Salt concentration (150-300 mM NaCl)

  • Glycerol addition (10-20%) for stability

  • Reducing agents (DTT or β-mercaptoethanol) if cysteine residues are present

• Storage conditions: The purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage, with avoidance of repeated freeze-thaw cycles .

How can researchers address common challenges in PSPTO_1628 recombinant expression?

Several challenges specifically associated with PSPTO_1628 expression can be addressed through the following approaches:

• Low expression yields:

  • Optimize codon usage for the expression host

  • Test different fusion partners (e.g., MBP, SUMO, or GST) to improve solubility

  • Implement auto-induction media or defined media formulations

  • Consider cell-free expression systems for toxic proteins

• Protein misfolding and aggregation:

  • Lower induction temperature (16-20°C)

  • Reduce inducer concentration

  • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ)

  • Add chemical chaperones to growth media (e.g., glycerol, arginine)

• Proteolytic degradation:

  • Use protease-deficient host strains

  • Include protease inhibitors during extraction and purification

  • Optimize buffer conditions to enhance stability

• Host cell stress responses:

  • Monitor growth curves to identify toxicity

  • Implement tight expression control systems

  • Use specialized strains designed to tolerate membrane protein overexpression

A systematic approach testing these variables is recommended, with detailed documentation of conditions and results to facilitate optimization.

What techniques are most appropriate for elucidating the structure of PSPTO_1628?

Given the challenges of membrane protein structural determination, a multi-method approach is recommended:

• Computational prediction:

  • AlphaFold2 and similar AI-based tools provide increasingly accurate structural predictions

  • Transmembrane topology prediction using TMHMM, Phobius, or TOPCONS

  • Homology modeling based on structurally characterized proteins in the UPF0060 family

• Experimental techniques:

  • X-ray crystallography: Requires generation of well-diffracting crystals, often facilitated by:

    • Lipidic cubic phase crystallization

    • Addition of stabilizing antibody fragments

    • Removal of flexible regions

  • Cryo-electron microscopy: Increasingly valuable for membrane proteins without requiring crystallization

  • NMR spectroscopy: Most suitable for smaller membrane proteins or domains

  • Limited proteolysis coupled with mass spectrometry to identify domain boundaries

  • Hydrogen-deuterium exchange mass spectrometry to probe solvent accessibility

• Validation approaches:

  • Site-directed mutagenesis of predicted functional residues

  • Disulfide cross-linking to validate predicted proximity relationships

  • Molecular dynamics simulations to assess structural stability

The choice of method should be guided by available resources, the specific research question, and the quantity of purified protein that can be obtained.

How can researchers investigate protein-protein interactions involving PSPTO_1628?

To elucidate the interactome of PSPTO_1628, researchers can employ these methodological approaches:

• In vivo approaches:

  • Bacterial two-hybrid systems adapted for membrane proteins

  • Co-immunoprecipitation studies using antibodies against PSPTO_1628 or its fusion tag

  • Proximity-dependent biotin labeling (BioID or APEX2) to identify proteins in close proximity

  • Genetic screens for synthetic lethality or suppressor mutations

• In vitro approaches:

  • Pull-down assays using purified PSPTO_1628

  • Surface plasmon resonance (SPR) or biolayer interferometry (BLI) for quantitative binding studies

  • Microscale thermophoresis (MST) for interaction studies in solution

  • Cross-linking mass spectrometry (XL-MS) to identify interaction interfaces

• Experimental design considerations:

  • Include appropriate controls (e.g., unrelated membrane proteins)

  • Verify interactions through reciprocal pull-downs

  • Validate biological relevance through functional assays

  • Consider detergent effects on protein-protein interactions

  • Test interactions under different physiological conditions

Of particular interest would be investigating potential interactions with CsrA1, given their genetic linkage , and exploring whether PSPTO_1628 forms homo-oligomeric complexes typical of many membrane transporters.

What functional assays can be employed to investigate the physiological role of PSPTO_1628?

Given the limited knowledge about PSPTO_1628's function, a comprehensive approach to functional characterization should include:

• Genetic approaches:

  • Generation of knockout and conditional mutants

  • Complementation studies with wild-type and mutated versions

  • Transcriptomic (RNA-seq) and proteomic analysis of knockout strains

  • Suppressor screens to identify genetic interactors

• Biochemical assays:

  • Transport assays if PSPTO_1628 is suspected to function as a transporter

  • Membrane integrity assays (fluorescent dye leakage)

  • Proton gradient measurements if involved in energy transduction

  • Lipid interaction studies if involved in membrane organization

• Physiological and virulence assays:

  • Growth assays under different stress conditions

  • Motility assays (swimming, swarming)

  • Plant infection assays to assess virulence

  • Biofilm formation assessment

  • Amino acid uptake assays, particularly for GABA and L-Pro, which are important for P. syringae pathogenicity

• Localization studies:

  • Fluorescent protein fusions to determine subcellular localization

  • Fractionation studies to confirm membrane association

  • Immunogold electron microscopy for precise localization

Each functional assay should be designed with appropriate controls and statistical analyses to ensure reliable interpretation of results.

How might PSPTO_1628 contribute to Pseudomonas syringae pathogenicity in tomato plants?

While direct evidence linking PSPTO_1628 to pathogenicity is limited, several hypotheses can be explored:

• Membrane integrity during infection:

  • PSPTO_1628 could maintain bacterial membrane homeostasis during exposure to plant defense compounds

  • It might participate in adaptation to the apoplastic environment, which undergoes significant changes during infection

• Nutrient acquisition:

  • If functioning as a transporter, it could facilitate uptake of specific nutrients available in the plant apoplast

  • It might be involved in the uptake of GABA or L-Pro, which are abundant in tomato apoplast and important for bacterial entry and infection

• Stress response:

  • Could function in detoxification or exclusion of antimicrobial compounds produced by the plant

  • Might participate in adaptation to changing osmotic conditions during infection

• Signaling or regulatory functions:

  • Given its genetic linkage to csrA1, it could participate in regulatory networks controlling virulence factor expression

  • May respond to plant-derived signals to coordinate appropriate bacterial responses

Research to test these hypotheses could include comparing the fitness of wild-type and PSPTO_1628 mutant strains during different stages of plant infection, analyzing gene expression patterns during infection, and assessing the protein's role in response to specific plant defense compounds.

What experimental approaches would best elucidate PSPTO_1628's role during plant infection?

To investigate PSPTO_1628's function during host-pathogen interactions, researchers should consider:

• In planta studies:

  • Competitive infection assays comparing wild-type and PSPTO_1628 mutant strains

  • Confocal microscopy of fluorescently labeled bacteria to track localization during infection

  • Transcriptome analysis of bacteria recovered from infected plants

  • In planta expression analysis using reporter fusions

• Plant response analysis:

  • Comparison of plant defense responses to wild-type versus mutant bacteria

  • Metabolomic analysis of plant tissue during infection

  • Measurement of reactive oxygen species and other defense compounds

  • Assessment of callose deposition and other physical barriers

• Specialized infection assays:

  • Quantification of bacterial entry through stomata

  • Assessment of bacterial survival in the apoplast

  • Evaluation of symptoms development and disease progression

  • Population dynamics studies in different plant tissues

• Experimental design recommendations:

  • Include multiple time points to capture dynamic changes

  • Use multiple plant genotypes to assess host-specific effects

  • Control environmental conditions carefully

  • Implement appropriate statistical analyses

  • Consider combinations with other virulence factor mutants to identify potential redundancy

These approaches should be complemented with biochemical studies of the purified protein to establish mechanistic understanding of any phenotypes observed during infection.

How does PSPTO_1628 compare to similar membrane proteins in other plant pathogens?

Comparative analysis provides valuable context for understanding PSPTO_1628's evolutionary significance:

• Homology analysis:

  • PSPTO_1628 shares homology with YnfA of E. coli, suggesting potential structural or functional conservation

  • Sequence comparison with UPF0060 family members across different bacterial species reveals evolutionary relationships

  • Analysis of selection pressure on different protein domains can identify functionally important regions

• Distribution patterns:

  • Presence/absence patterns in different Pseudomonas pathovars may correlate with host specificity

  • Conservation across diverse plant pathogens would suggest fundamental roles in bacterial physiology

  • Pathovar-specific variants might indicate adaptation to particular host environments

• Functional equivalence testing:

  • Cross-complementation experiments with homologs from other bacteria

  • Domain swapping to identify regions responsible for specific functions

  • Heterologous expression to determine if functional properties are conserved

• Structural comparison:

  • Alignment of predicted secondary structures

  • Identification of conserved motifs or residues

  • Mapping of pathogen-specific variations onto structural models

This comparative analysis should be presented in a comprehensive table format documenting:

• Sequence identity percentages

• Conserved domains and motifs

• Host range of organisms containing homologs

• Known functions of characterized homologs

• Predicted structural similarities

How can PSPTO_1628 be used to develop novel control strategies for bacterial speck disease?

Leveraging knowledge about PSPTO_1628 could lead to innovative disease management approaches:

• Target-based inhibitor development:

  • If PSPTO_1628 is essential for virulence, small molecule inhibitors could be designed

  • Structure-based drug design approaches once the protein structure is determined

  • High-throughput screening of compound libraries against purified protein

  • Peptidomimetic approaches targeting protein-protein interaction interfaces

• Host resistance engineering:

  • Development of plant variants expressing inhibitors of PSPTO_1628

  • Engineering plant receptors to recognize PSPTO_1628 or its activities

  • Modifying plant metabolism to create less favorable conditions for PSPTO_1628 function

• Diagnostic applications:

  • PSPTO_1628-specific antibodies for bacterial detection

  • PCR-based methods targeting the PSPTO_1628 gene for pathogen identification

  • Development of biosensors incorporating the purified protein

• Experimental considerations:

  • Assess potential off-target effects on beneficial microbiota

  • Evaluate durability of resistance strategies

  • Test efficacy under field conditions

  • Consider regulatory and public acceptance factors for engineered solutions

While these applications represent advanced research directions, they depend on first establishing the fundamental importance of PSPTO_1628 in bacterial virulence and survival.

What methodological approaches would be most effective for studying PSPTO_1628 in the context of the bacterial membrane environment?

To understand PSPTO_1628's behavior in its native membrane context:

• Reconstitution systems:

  • Incorporation into proteoliposomes of defined lipid composition

  • Nanodiscs assembly for single-particle studies

  • Supported lipid bilayers for surface-sensitive techniques

  • Giant unilamellar vesicles for microscopy-based assays

• Biophysical characterization:

  • Fluorescence spectroscopy with environment-sensitive probes

  • Atomic force microscopy to assess protein distribution and clustering

  • Solid-state NMR to probe protein dynamics in membranes

  • Neutron reflectometry to determine orientation within the bilayer

• Functional assessment in membrane context:

  • Electrophysiology if channel or transporter function is suspected

  • Stopped-flow spectroscopy for transport kinetics

  • Fluorescence correlation spectroscopy for diffusion properties

  • Measurement of lipid-protein interactions using specialized assays

• Membrane mimetic screening:

  Membrane Mimetic	Advantages	Limitations	Best Applications
  Detergent micelles	Simple preparation, good for spectroscopy	Non-native environment	Initial structural studies
  Bicelles	Disc-shaped, bilayer character	Limited stability	NMR studies
  Nanodiscs	Defined size, stable, accessible surfaces	Complex assembly	Single-molecule studies
  Liposomes	Native-like bilayer, compartmentalization	Heterogeneity	Transport assays
  Native membranes	Authentic lipid and protein environment	Complex composition	In situ studies

These methodologies should be selected based on the specific research question and the properties of PSPTO_1628 being investigated.

How might systems biology approaches advance our understanding of PSPTO_1628's role in cellular networks?

Integration of PSPTO_1628 into broader cellular contexts requires:

• Multi-omics integration:

  • Comparative transcriptomics of wild-type vs. PSPTO_1628 mutants

  • Proteomics to identify abundance changes and post-translational modifications

  • Metabolomics to detect metabolic shifts

  • Fluxomics to measure changes in metabolic pathway activities

  • Network analysis to identify affected pathways

• Computational modeling:

  • Incorporation of PSPTO_1628 into genome-scale metabolic models

  • Protein-protein interaction network analysis

  • Signal transduction pathway modeling

  • Constraint-based modeling to predict phenotypic consequences

• High-throughput interaction studies:

  • Synthetic genetic arrays to identify genetic interactions

  • Chemical genomics to identify small molecules affecting PSPTO_1628 function

  • Interactome mapping using mass spectrometry-based approaches

• Data integration frameworks:

  • Development of databases integrating experimental data

  • Machine learning approaches to predict functions

  • Visualization tools for complex datasets

  • Statistical methods for multi-dimensional data analysis

The resulting integrated view would position PSPTO_1628 within its functional context and could reveal unexpected connections to cellular processes not apparent from traditional reductionist approaches.

What are the most promising avenues for future research on PSPTO_1628?

Based on current knowledge gaps, priority research directions include:

• Structural determination:

  • High-resolution structure through cryo-EM or X-ray crystallography

  • Identification of functional domains and critical residues

  • Structural dynamics studies under different conditions

• Functional characterization:

  • Definitive identification of transported substrates or binding partners

  • Elucidation of the mechanism of action

  • Determination of regulation under different environmental conditions

  • Integration with virulence regulation networks

• Host-pathogen interaction studies:

  • Role during different stages of infection

  • Response to plant defense compounds

  • Contribution to bacterial survival in planta

  • Potential recognition by plant immune receptors

• Translational research:

  • Development of specific inhibitors

  • Engineering of resistant plant varieties

  • Exploitation for pathogen detection

Each of these directions should build upon established knowledge while addressing fundamental gaps in understanding this membrane protein's biology.

What technical innovations would accelerate research on PSPTO_1628 and similar membrane proteins?

Advancing research on challenging membrane proteins like PSPTO_1628 would benefit from:

• Expression and purification innovations:

  • Development of specialized expression hosts optimized for plant bacterial membrane proteins

  • New detergents or solubilization agents that better maintain native structure

  • Cell-free expression systems optimized for membrane proteins

  • Automated purification platforms for membrane proteins

• Structural biology advances:

  • Improved methods for membrane protein crystallization

  • Higher sensitivity cryo-EM for smaller membrane proteins

  • Advanced computational prediction specifically for membrane proteins

  • Hybrid methods combining multiple structural techniques

• Functional characterization tools:

  • High-throughput substrate screening platforms

  • Microfluidic systems for single-cell analysis

  • Advanced imaging techniques with higher spatial and temporal resolution

  • Biosensors for real-time monitoring of protein activity

• In vivo study improvements:

  • Better genetic tools for Pseudomonas syringae

  • Non-invasive imaging techniques for tracking bacteria in plants

  • Single-cell sequencing applications for bacteria during infection

  • Plant tissue culture systems that better recapitulate infection environments

The integration of these technological advances would significantly accelerate progress in understanding PSPTO_1628 and similar challenging membrane proteins.

How can inconsistencies in the existing literature about PSPTO_1628 be reconciled?

While the literature on PSPTO_1628 specifically is limited, researchers should address inconsistencies through:

• Standardization approaches:

  • Adoption of common experimental conditions across studies

  • Use of consistent strain backgrounds and genetic constructs

  • Establishment of benchmark assays for functional characterization

  • Development of validated antibodies or detection methods

• Methodology refinement:

  • Careful consideration of tag positioning and its effects on function

  • Evaluation of detergent effects on protein properties

  • Assessment of expression levels compared to native conditions

  • Validation across multiple experimental approaches

• Data integration strategies:

  • Meta-analysis of existing studies

  • Development of databases collecting disparate observations

  • Statistical approaches to weight evidence from different methodologies

  • Community-driven consensus building through collaborative projects

• Reporting recommendations:

  • Detailed methods sections including exact buffer compositions

  • Raw data sharing through repositories

  • Explicit discussion of limitations and potential artifacts

  • Comprehensive reporting of negative results