Recombinant Pseudomonas syringae pv. tomato UPF0114 protein PSPTO_4583 (PSPTO_4583)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us; we will prioritize development to meet your specifications.
Synonyms
PSPTO_4583; UPF0114 protein PSPTO_4583
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Target Names
PSPTO_4583
Target Protein Sequence
MERFFENAMYASRWLLAPIYFGLSLGLLALCLKFFQEIFHVIPNIFSLAEADLILVLLSL IDMALVGGLLVMVMISGYENFVSQLDIDEDKEKLNWLGTMDSSSLKMKVAASIVAISSIH LLRVFMDATNIKPEYLMWYVIIHMTFVISAFAMGYLDKLTKH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Pseudomonas syringae pv. tomato UPF0114 protein PSPTO_4583 and what are its structural characteristics?

The PSPTO_4583 protein is a member of the UPF0114 protein family found in Pseudomonas syringae pv. tomato strain DC3000, a significant bacterial plant pathogen that affects tomato plants . Structurally, PSPTO_4583 consists of 162 amino acids with a sequence beginning with MERFFENAMYASRWLLAPI and continuing through to LDKLTKH at its C-terminus . The protein features hydrophobic regions consistent with membrane association, including transmembrane helices that suggest integration into bacterial membranes . The UniProt accession number for this protein is Q87WG7, and it contains specific structural motifs characteristic of the UPF0114 family . Analysis of its primary sequence indicates potential functional domains that may contribute to bacterial pathogenicity or membrane integrity during host infection processes . The protein's structure likely facilitates its predicted role in bacterial attachment to plant surfaces during the early stages of infection .

How does the PSPTO_4583 protein participate in the pathogenicity mechanisms of Pseudomonas syringae?

The PSPTO_4583 protein appears to be involved in the complex pathogenicity mechanisms of Pseudomonas syringae pv. tomato, particularly in the context of bacterial attachment to plant surfaces and subsequent infection processes . While not directly part of the type III secretion system (T3SS) that delivers effector proteins into host cells, PSPTO_4583 may function within pathways related to plant-bacteria interactions that influence attachment and colonization . Research suggests that proteins in Pseudomonas syringae respond to plant-derived chemical signals that induce surface attachment, which represents a critical early stage in the infection process . PSPTO_4583 may be co-regulated with virulence factors under the control of the HrpL regulator, which governs expression of the T3SS and associated virulence factors . Surface attachment is a prerequisite for effective deployment of the T3SS apparatus, making PSPTO_4583 potentially important in establishing the physical contact needed for the syringe-like T3SS to span the plant cell wall and deliver effectors . This attachment mechanism appears to be induced by specific metabolites exuded by plant tissues, suggesting that PSPTO_4583 might participate in sensing or responding to these host-derived signals .

What methods are recommended for optimal storage and handling of recombinant PSPTO_4583 protein in laboratory settings?

For optimal preservation of recombinant PSPTO_4583 protein activity, store the protein at -20°C for regular use or at -80°C for long-term storage to minimize degradation and maintain structural integrity . The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which helps prevent freeze-thaw damage and maintains protein stability . When working with the protein, prepare small working aliquots (typically 10-20 μL) to be stored at 4°C for up to one week to avoid repeated freeze-thaw cycles that can compromise protein functionality . Prior to experimental use, gently thaw frozen aliquots on ice rather than at room temperature to preserve structural integrity and biological activity . For optimal results in functional assays, centrifuge the protein solution briefly after thawing to collect any precipitated material and use only the clear supernatant in experiments . When diluting the protein, use buffers compatible with downstream applications, and consider adding stabilizing agents such as bovine serum albumin (BSA) at 0.1-1.0 mg/mL to prevent non-specific adsorption to tube surfaces .

What experimental approaches are effective for studying PSPTO_4583 interactions with plant host surfaces?

To investigate PSPTO_4583 interactions with plant surfaces, implement a multi-faceted approach combining microscopy, biochemical analysis, and genetic manipulation techniques . Begin with crystal violet staining assays of bacterial attachment to both abiotic surfaces and plant tissues, comparing wild-type Pseudomonas syringae with PSPTO_4583 deletion mutants to quantify differential attachment capabilities . Fluorescently tag the PSPTO_4583 protein with GFP for real-time confocal microscopy visualization of protein localization during bacterial attachment to plant surfaces, enabling direct observation of protein recruitment during the attachment process . Implement bacterial two-hybrid or pull-down assays to identify potential protein partners that interact with PSPTO_4583 during attachment, providing insights into the molecular complexes formed during this process . Conduct surface plasmon resonance or biolayer interferometry analyses using purified PSPTO_4583 protein and extracted plant cell wall components to determine binding affinities and kinetics of protein-surface interactions . Additionally, perform site-directed mutagenesis of key residues in PSPTO_4583 to identify critical binding domains, followed by in planta assays comparing attachment efficiency of these mutants to wild-type bacteria .

How can researchers effectively measure the contribution of PSPTO_4583 to bacterial surface attachment in experimental systems?

Researchers can quantitatively assess PSPTO_4583's contribution to bacterial surface attachment using crystal violet staining of attached bacteria, followed by destaining and spectrophotometric measurement at 562 nm to provide a standardized measure of attachment intensity . For more precise quantification, implement enumeration of both planktonic and attached bacterial populations through serial dilution plating, which allows calculation of the attachment efficiency as the ratio of attached cells to total cells . Compare wild-type Pseudomonas syringae with PSPTO_4583 knockout mutants and complemented strains across various surface types, including polystyrene plates, glass culture tubes, and plant tissue surfaces to determine substrate specificity . Time-course experiments capturing attachment dynamics over periods ranging from 1 to 24 hours can reveal the temporal role of PSPTO_4583 in the attachment process . Evaluate attachment under various environmental conditions (pH, temperature, ionic strength) to identify optimal parameters for PSPTO_4583-mediated attachment, providing insights into the protein's functional requirements . Additionally, incorporate competitive inhibition assays using antibodies against PSPTO_4583 or synthetic peptides mimicking binding domains to confirm specific involvement of this protein in the attachment mechanism .

What approaches are recommended for investigating the relationship between PSPTO_4583 and the type III secretion system (T3SS) in Pseudomonas syringae?

To investigate the relationship between PSPTO_4583 and the T3SS, implement a coordinated gene expression analysis using quantitative RT-PCR to monitor transcription levels of both PSPTO_4583 and key T3SS genes under various environmental conditions and during different stages of plant infection . Generate targeted gene knockouts of PSPTO_4583, hrpL (the T3SS master regulator), and gacA (a negative regulator of T3SS) in isolation and combination, then assess the resulting effects on both T3SS function and surface attachment through biochemical and microscopy techniques . Utilize chromatin immunoprecipitation (ChIP) assays with HrpL antibodies to determine if HrpL directly binds to the PSPTO_4583 promoter region, thereby establishing direct regulatory connections . Conduct protein-protein interaction studies using co-immunoprecipitation or bacterial two-hybrid systems to identify potential physical interactions between PSPTO_4583 and structural or regulatory components of the T3SS . Perform comparative transcriptomics using RNA-seq on wild-type, ΔPSPTO_4583, ΔhrpL, and ΔgacA strains exposed to plant signals to establish the global regulatory networks connecting these systems . The data generated should be analyzed for co-regulation patterns that might indicate functional relationships between PSPTO_4583 and the T3SS apparatus, potentially revealing how surface attachment is coordinated with T3SS deployment during infection .

How do plant-derived signals regulate PSPTO_4583 function in the context of bacterial chemotaxis and infection?

Plant-derived chemical signals, particularly amino acids like GABA (γ-aminobutyric acid) and L-proline, play crucial roles in regulating bacterial chemotaxis and surface attachment processes that likely involve PSPTO_4583 . These compounds act as chemoattractants that are recognized by specific bacterial chemoreceptors, such as PsPto-PscC, triggering directed movement toward plant tissues and subsequent attachment processes . When investigating this regulatory pathway, researchers should examine how exudates from different plant tissues (seedlings, leaves, roots) affect PSPTO_4583 expression and bacterial attachment efficiency through quantitative PCR and attachment assays . Notably, GABA and L-proline levels significantly increase in tomato plants upon pathogen infection, suggesting a dynamic interplay between host defense responses and bacterial perception systems . This plant signal perception appears to be integrated into a coordinated bacterial response where both T3SS deployment and surface attachment mechanisms (potentially involving PSPTO_4583) are co-regulated, enabling strategic colonization of the plant apoplast . Experimental approaches should include comparing wild-type plants with defense-response mutants (such as the Arabidopsis mkp1 mutant) to determine how altered plant signal production affects PSPTO_4583-dependent attachment phenotypes .

What is the relationship between PSPTO_4583 and bacterial adaptation to the plant apoplastic environment?

The relationship between PSPTO_4583 and bacterial adaptation to the plant apoplast appears to involve sensing environmental cues and mediating appropriate bacterial responses that facilitate survival in this specialized intercellular space . The apoplast represents a distinct microenvironment with specific nutrient compositions, antimicrobial compounds, and physical constraints that bacteria must navigate to establish successful infections . PSPTO_4583 may function in conjunction with chemosensory pathways that detect plant-derived compounds like GABA and L-proline, which are abundant components of the tomato apoplast and serve as important chemical signals during plant-pathogen interactions . To investigate this relationship, researchers should design experiments comparing bacterial gene expression profiles and attachment behaviors in artificial media versus apoplastic fluid extracted from both healthy and infected plants . Comparative proteomics of bacterial membrane fractions can identify whether PSPTO_4583 protein levels change in response to apoplastic conditions, potentially indicating adaptive roles . Additionally, exposure of Pseudomonas syringae to different osmotic, pH, and oxidative stress conditions that mimic apoplastic changes during infection may reveal stress-response roles for PSPTO_4583 that contribute to bacterial persistence . Constructing biosensor strains with PSPTO_4583 promoter fusions to reporter genes could enable real-time monitoring of gene expression changes during apoplast colonization in planta .

How might structural modifications of PSPTO_4583 impact its function in bacterial attachment and virulence?

Structural modifications of PSPTO_4583 through targeted mutagenesis approaches can provide critical insights into structure-function relationships that govern its role in bacterial attachment and virulence . By analyzing the 162-amino acid sequence of PSPTO_4583, researchers can identify conserved domains and potential functional motifs for targeted site-directed mutagenesis, particularly focusing on the hydrophobic regions that may facilitate membrane integration or surface interactions . The transmembrane prediction analysis reveals multiple hydrophobic segments (such as the LLAPIYFGLSLGLLALCLK region) that likely anchor the protein in the bacterial membrane, providing targets for substitution mutations to assess membrane localization requirements . Systematic alanine-scanning mutagenesis of surface-exposed residues can identify specific amino acids essential for protein-protein interactions or binding to plant surfaces . Researchers should generate a panel of mutant variants expressed in a ΔPSPTO_4583 background strain, then evaluate their capacity to restore wild-type levels of surface attachment using crystal violet assays and enumeration of attached bacteria . Circular dichroism spectroscopy and thermal stability assays of purified mutant proteins can determine whether structural changes correlate with functional deficits . Additionally, in planta virulence assays comparing wild-type and mutant strains can establish direct connections between specific structural features of PSPTO_4583 and bacterial pathogenicity in tomato plants .

What factors should be considered when designing experiments to study PSPTO_4583 in the context of plant-pathogen interactions?

When designing experiments to study PSPTO_4583 in plant-pathogen interactions, researchers must carefully consider both bacterial strain selection and plant host variables . Choose appropriate Pseudomonas syringae pv. tomato strains, including wild-type DC3000, PSPTO_4583 deletion mutants, and complemented strains carrying the wild-type gene or specifically mutated variants to enable comparative analyses . Select compatible plant hosts such as tomato (Solanum lycopersicum) or Arabidopsis thaliana, and consider using both susceptible and resistant varieties to assess PSPTO_4583's role across different host-resistance backgrounds . Environmental conditions significantly impact bacterial gene expression and plant defense responses, so standardize temperature, humidity, light conditions, and soil composition across experiments while also considering manipulating these variables to test environmental effects on PSPTO_4583 function . Infection methodologies must be carefully standardized, whether using leaf infiltration, spray inoculation, or wound infection approaches, with bacterial inoculum concentrations precisely controlled and verified through plating efficiency tests . Temporal considerations are crucial - design time-course experiments that capture early attachment events (1-6 hours post-inoculation) through later infection stages (24-72 hours) to fully characterize PSPTO_4583's dynamic role throughout the infection process . Additionally, include appropriate controls for each experimental condition, such as mock-inoculated plants, plants treated with heat-killed bacteria, and infections with unrelated bacterial pathogens to distinguish specific PSPTO_4583-mediated effects from general pathogenesis processes .

What are the appropriate controls and validation methods for studying PSPTO_4583 gene expression and protein function?

To ensure rigorous investigation of PSPTO_4583 gene expression and protein function, implement a comprehensive set of controls and validation methods throughout your experimental workflow . For gene expression studies, include housekeeping genes (such as 16S rRNA, rpoD, or gyrB) as internal reference controls for qRT-PCR normalization, and validate expression patterns using at least two independent RNA extraction and cDNA synthesis replicates . When analyzing protein levels, utilize both N-terminal and C-terminal epitope tags to confirm that tag placement doesn't interfere with protein localization or function, and validate antibody specificity using PSPTO_4583 knockout strains as negative controls . For functional complementation experiments, include both positive controls (wild-type gene reintroduction) and negative controls (empty vector and functionally impaired mutant variants) to establish the specificity of phenotype restoration . When assessing bacterial attachment, compare results across multiple surface types (polystyrene, glass, plant tissue) and quantify using both crystal violet staining and direct enumeration of colony-forming units to prevent methodological artifacts . To validate protein-protein interactions, confirm findings using multiple independent techniques (bacterial two-hybrid, co-immunoprecipitation, proximity ligation) and include known interacting and non-interacting protein pairs as controls . For in planta experiments, include mock-inoculated plants, plants infected with virulent and avirulent bacterial strains, and appropriate time points to distinguish PSPTO_4583-specific effects from general infection responses .

How can researchers effectively integrate multi-omics approaches to comprehensively study PSPTO_4583 function?

To comprehensively characterize PSPTO_4583 function, researchers should integrate multiple omics technologies within a coordinated experimental framework, beginning with comparative genomics to identify homologs across Pseudomonas species and related plant pathogens, establishing evolutionary context and potential conserved functions . Implement transcriptomic analyses using RNA-seq to profile global gene expression changes in wild-type versus PSPTO_4583 mutant strains under various conditions (minimal media, plant extract exposure, in planta infection), identifying co-regulated gene networks and potential regulatory connections to virulence systems . Complement this with proteomics approaches including quantitative mass spectrometry to analyze protein abundance changes and post-translational modifications that might regulate PSPTO_4583 activity during infection stages . Integrate metabolomic analyses to identify bacterial metabolic changes associated with PSPTO_4583 function and to characterize plant-derived compounds that influence its activity, particularly focusing on compounds like GABA and L-proline that have been implicated in chemotaxis and attachment processes . Perform chromatin immunoprecipitation sequencing (ChIP-seq) with transcriptional regulators like HrpL to identify direct regulatory interactions with the PSPTO_4583 promoter region . Utilize interactome mapping through techniques like BioID or cross-linking mass spectrometry to identify the complete set of protein-protein interactions involving PSPTO_4583 during different infection phases . Finally, develop computational models integrating these multi-omics datasets to predict PSPTO_4583's functional role within the broader network of bacterial virulence systems and host interactions, generating testable hypotheses for experimental validation .

What are the common technical challenges in characterizing PSPTO_4583 protein interactions and how can they be addressed?

Characterizing PSPTO_4583 protein interactions presents several technical challenges that require specific methodological solutions . Membrane localization of PSPTO_4583 complicates isolation and interaction studies, necessitating specialized extraction protocols using mild detergents like n-dodecyl-β-D-maltoside or digitonin that maintain protein structure while solubilizing membrane components . Expression level inconsistencies between experimental batches can be minimized through the use of tightly regulated inducible promoter systems and quantitative Western blotting to normalize protein amounts across experiments . Non-specific interactions in pull-down assays can be distinguished from genuine interactions by implementing stringent washing steps and comparing results with those obtained using structurally similar but functionally distinct control proteins . Difficulty in detecting transient or weak interactions can be addressed through the use of chemical cross-linking coupled with mass spectrometry (XL-MS) or proximity-dependent biotin identification (BioID) approaches that capture even brief associations . The potential for artifactual interactions resulting from overexpression systems should be mitigated by validating key findings using endogenous protein levels through CRISPR-mediated epitope tagging of chromosomal genes . Additionally, conformational changes in PSPTO_4583 that might occur during plant signal perception can be monitored using hydrogen-deuterium exchange mass spectrometry or fluorescence resonance energy transfer (FRET) biosensors constructed with strategically placed fluorophores .

How should researchers interpret conflicting data regarding PSPTO_4583 function in different experimental systems?

When confronted with conflicting data regarding PSPTO_4583 function across different experimental systems, researchers should implement a systematic analytical approach to resolve these discrepancies . Begin by carefully evaluating methodological differences between studies, including bacterial strain backgrounds, growth conditions, and experimental timeframes that might account for functional variations . Consider genetic context effects, as PSPTO_4583 function may depend on the presence of specific regulatory networks or partner proteins that vary between laboratory strains or clinical isolates . Environmental factors significantly influence bacterial gene expression and protein function, so assess whether differences in temperature, pH, nutrient availability, or plant-derived signals across experimental systems could explain functional discrepancies . Implement dose-response experiments to determine whether conflicting results might represent different points on a concentration-dependent response curve rather than fundamental functional differences . When in vitro and in planta results conflict, recognize that the complex plant environment introduces variables absent from controlled laboratory conditions, including plant defense responses and spatial constraints that may alter PSPTO_4583 activity . Utilize complementary approaches such as combining genetic knockout studies with biochemical assays and microscopy techniques to build a more comprehensive understanding that reconciles apparently contradictory findings . Finally, consider the possibility that PSPTO_4583 may have multiple distinct functions depending on cellular context, bacterial life stage, or specific environmental triggers, which would explain seemingly inconsistent results across different experimental paradigms .

What statistical approaches are most appropriate for analyzing PSPTO_4583 contribution to virulence in plant infection models?

When analyzing PSPTO_4583's contribution to virulence in plant infection models, researchers should implement robust statistical approaches that account for the biological complexity and variability inherent in plant-pathogen systems . For bacterial growth assays within plant tissues, use repeated measures ANOVA with post-hoc tests (such as Tukey's HSD) to analyze time-course data from wild-type and PSPTO_4583 mutant strains, ensuring that temporal dynamics of infection are properly captured . When quantifying disease symptoms, employ ordinal logistic regression models for categorical symptom severity scales or mixed-effects models that account for both fixed (bacterial strain, plant genotype) and random (experimental batch, plant-to-plant variability) effects . Consider non-parametric alternatives such as Mann-Whitney U tests or Kruskal-Wallis tests when data violate normal distribution assumptions, which is common with disease severity measurements . For attachment assays, implement two-way ANOVA to assess both bacterial strain effects and surface type interactions, followed by appropriate post-hoc tests to identify specific differences between experimental conditions . Statistical power calculations should be performed a priori to determine adequate sample sizes, typically requiring 15-30 plants per treatment group to detect biologically meaningful differences in bacterial growth or symptom development . Employ multivariate statistical approaches such as principal component analysis or partial least squares discriminant analysis when integrating multiple virulence-related measurements (bacterial growth, symptom development, plant defense gene expression) to identify patterns not apparent in univariate analyses . Finally, validate key findings through independent experimental replication and, when possible, across multiple plant genotypes or species to establish the generalizability of PSPTO_4583's contribution to virulence .

What emerging technologies could advance our understanding of PSPTO_4583's role in bacterial pathogenesis?

Emerging technologies offer unprecedented opportunities to elucidate PSPTO_4583's role in bacterial pathogenesis with greater precision and contextual understanding . Advanced cryo-electron microscopy techniques could reveal the three-dimensional structure of PSPTO_4583 in its native membrane environment, providing insights into functional domains and potential interaction interfaces that drive bacterial attachment to plant surfaces . CRISPR-Cas9-based gene editing with homology-directed repair now enables precise, scarless chromosomal modifications in Pseudomonas syringae, allowing researchers to introduce specific amino acid substitutions or reporter tags at the endogenous PSPTO_4583 locus to study function without disrupting native gene regulation . Single-cell RNA sequencing of bacterial populations during plant infection could reveal heterogeneity in PSPTO_4583 expression and identify distinct bacterial subpopulations with specialized functions during the infection process . Real-time in planta imaging using plant-microbe interaction microscopy chambers combined with fluorescently tagged PSPTO_4583 would enable visualization of protein dynamics during the attachment process, providing temporal and spatial context to static biochemical data . Advanced biosensors incorporating fluorescence resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) technologies could detect conformational changes in PSPTO_4583 upon interaction with plant-derived signals such as GABA or L-proline . Additionally, integrating machine learning approaches with multi-omics datasets could predict novel functions and interaction partners for PSPTO_4583, generating hypotheses for experimental validation and potentially revealing unexpected roles in bacterial virulence networks .

What are the potential applications of understanding PSPTO_4583 function for developing novel plant protection strategies?

Understanding PSPTO_4583 function creates several promising avenues for developing novel plant protection strategies that target specific aspects of bacterial pathogenesis . If PSPTO_4583 proves essential for bacterial attachment to plant surfaces, researchers could develop peptide or small molecule inhibitors that specifically bind to the protein and prevent its interaction with plant cell walls, effectively blocking the initial infection stage . Given the apparent co-regulation of PSPTO_4583 with virulence factors like the T3SS, targeting shared regulatory pathways could simultaneously disrupt multiple aspects of the infection process, potentially increasing the durability of resistance against evolutionary adaptation . Understanding how plant-derived signals like GABA and L-proline regulate PSPTO_4583 function could inform the development of modified plant varieties with altered exudation profiles that no longer trigger bacterial attachment responses, effectively creating a chemical barrier to infection . Structural characterization of PSPTO_4583 could enable rational design of antimicrobial peptides that specifically disrupt its membrane integration or protein-protein interactions, offering narrowly targeted antibacterial agents that minimize impacts on beneficial microbiota . Knowledge of PSPTO_4583's role could also support development of diagnostic tools that detect expression of this protein as an early biomarker of Pseudomonas syringae infection, enabling timely intervention before visible symptoms appear . Additionally, understanding the regulatory networks controlling PSPTO_4583 expression might reveal environmental conditions or plant defense responses that naturally suppress its function, informing agricultural practices that enhance natural plant resistance mechanisms .

How might comparative analysis of PSPTO_4583 homologs across bacterial species advance our understanding of conserved virulence mechanisms?

Comparative analysis of PSPTO_4583 homologs across diverse bacterial species offers a powerful approach to identifying conserved virulence mechanisms and evolutionary adaptations in plant-pathogen interactions . By constructing phylogenetic trees based on UPF0114 family proteins from various bacterial pathogens, researchers can trace the evolutionary history of this protein family and identify selective pressures that have shaped its function across different host-pathogen systems . Systematic structure-function comparisons between PSPTO_4583 and homologs from other Pseudomonas species, as well as more distantly related plant pathogens like Xanthomonas and Ralstonia, could reveal conserved functional domains essential for bacterial attachment across multiple pathosystems . Heterologous expression experiments in which PSPTO_4583 homologs from other bacterial species are introduced into a ΔPSPTO_4583 P. syringae background would determine the degree of functional conservation and identify species-specific adaptations . Comparative genomics approaches analyzing the genomic context of PSPTO_4583 homologs could reveal conserved operon structures or regulatory elements that indicate functional associations maintained throughout evolution . Multi-species transcriptomic analyses comparing expression patterns of PSPTO_4583 homologs during infection of their respective host plants might identify common environmental triggers and regulatory networks controlling these proteins . Additionally, systematic mutagenesis of conserved versus variable regions across homologs could distinguish core functional domains from species-specific adaptations, providing insights into how these proteins have evolved to optimize virulence in specific host-pathogen contexts .

What are the key unresolved questions regarding PSPTO_4583 function in bacterial virulence?

Despite significant advances in understanding PSPTO_4583, several critical questions remain unresolved regarding its precise function in bacterial virulence mechanisms . The exact molecular mechanism by which PSPTO_4583 facilitates bacterial attachment to plant surfaces remains unclear, particularly whether it functions as a direct adhesin or as a regulatory protein that controls expression of other attachment factors . The specific plant surface components that interact with PSPTO_4583 during the attachment process have not been definitively identified, leaving gaps in our understanding of the molecular basis for host recognition . The regulatory relationship between PSPTO_4583 and the type III secretion system requires further clarification, especially regarding whether these systems are merely co-regulated or functionally interdependent during infection . The potential role of PSPTO_4583 in sensing and responding to plant-derived signals like GABA and L-proline remains speculative and needs direct experimental validation to establish mechanistic connections . The contribution of PSPTO_4583 to bacterial fitness within the plant apoplast following initial attachment is poorly understood, particularly whether it continues to function during later infection stages . The evolutionary history of PSPTO_4583 across Pseudomonas species and its potential horizontal transfer between bacterial lineages represent important questions for understanding pathogen adaptation . Additionally, the potential of PSPTO_4583 as a target for novel antimicrobial interventions remains theoretical without experimental validation of its essentiality for virulence across diverse plant hosts and environmental conditions .

What consensus has emerged about the importance of PSPTO_4583 in Pseudomonas syringae infection biology?

A growing consensus has emerged regarding PSPTO_4583's importance in Pseudomonas syringae infection biology, though many mechanistic details remain to be fully elucidated . Evidence consistently indicates that PSPTO_4583 plays a significant role in bacterial attachment to surfaces, which represents a critical initial step in the infection process and precedes deployment of specialized virulence mechanisms like the type III secretion system . The co-regulation of PSPTO_4583 with known virulence factors under the control of the HrpL regulator suggests its integration into the broader virulence program of Pseudomonas syringae, rather than functioning as an isolated factor . Research has established that plant-derived signals induce both surface attachment and expression of T3SS components, with PSPTO_4583 likely participating in this coordinated response to host-derived cues . The structural features of PSPTO_4583, including its transmembrane domains, position it as a potential interface between the bacterium and its environment, consistent with roles in attachment or signal perception . The apparent requirement for HrpL in maximizing PSPTO_4583-associated attachment phenotypes and the suppressive effect of GacA on this process align with established regulatory patterns for virulence factors in Pseudomonas syringae . Additionally, the conservation of UPF0114 family proteins across multiple bacterial pathogens suggests that PSPTO_4583 represents a component of a broadly important virulence mechanism that has been maintained throughout the evolution of plant-pathogenic bacteria .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.