Recombinant Psilotum nudum Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a particular tag, please specify it for preferential development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-321
Protein Length
Full Length of Mature Protein
Species
Psilotum nudum (Whisk fern) (Lycopodium nudum)
Target Names
petA
Target Protein Sequence
YPIFAQQSYENPREATGRIVCANCHLAKKPVDIEVPQSVFPNTVFEAVVKIPYDKQIKQV LGNGKKGGINVGAVLILPEGFELAPYNRIPAEMKDKIGDLALFQNYRPDKRNIIVIGPVP GKAYSEIVFPLISPDPATNKEVHFLKYPIYLGGNRGRGQIYPDGSKSNNTIYNASIAGKV TKILRREKGGYEITIEDTLEGRRVVDIVPPGPELIISEGEFIKIDQPLTNNPNLGGFGQG DTEIVLQNPLRIQGLLLFFVSVIMAQILLVLKKKQFEKVQLAEMNL
Uniprot No.

Target Background

Function

Recombinant Psilotum nudum Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what is its significance in Psilotum nudum?

Apocytochrome f, encoded by the petA gene, is a crucial component of the cytochrome b6f complex in the photosynthetic electron transport chain of Psilotum nudum. This protein plays an essential role in mediating electron transfer between photosystem II and photosystem I during photosynthesis. In Psilotum nudum, which represents an early-diverging lineage of vascular plants, studying this protein provides valuable insights into the evolution of photosynthetic mechanisms. The protein consists of 321 amino acids with a recommended expression region spanning residues 36-321, as identified in the UniProt database (Q8WI07) .

As a member of the whisk fern family (Psilotaceae), P. nudum exhibits unique anatomical features, including conducting tissues but lacking true leaves and roots, making it an interesting model for studying the evolution of plant structures and their associated biochemical pathways . While historically considered primitive, recent phylogenetic studies suggest these features represent reduction from more typical modern fern morphology rather than ancestral traits.

What are the structural characteristics of Psilotum nudum Apocytochrome f?

Psilotum nudum Apocytochrome f has several key structural features that are important for its function. The protein sequence contains a CXXCH motif (specifically involving cysteine residues) that forms the heme-binding pocket, essential for its electron transfer function. The amino acid sequence "YPIFAQQSYENPREATGRIVCANCHLAKKPVDIEVPQSVFPNTVFEAVVKIPYDKQIKQVLGNGKKGGINVGAVLILPEGFELAPYNRIPAEMKDKIGDLALFQNYRPDKRNIIVIGPVPGKAYSEIVFPLISPDPATNKEVHFLKYPIYLGGNRGRGQIYPDGSKSNNTIYNASIAGKVTKILRREKGGYEITIEDTLEGRRVVDIVPPGPELIISEGEFIKIDQPLTNNPNLGGFGQGDTEIVLQNPLRIQGLLLFFVSVIMAQILLVLKKKQFEKVQLAEMNL" reveals conserved regions that are critical for maintaining the protein's structure and function .

The protein typically contains a membrane-spanning domain near the C-terminus, which anchors it to the thylakoid membrane. This structural arrangement is significant for proper positioning within the electron transport chain. Research methodologies focused on studying these structural characteristics typically involve biophysical techniques such as circular dichroism spectroscopy to analyze secondary structure and thermal stability profiles.

How can researchers effectively express recombinant Psilotum nudum Apocytochrome f?

For successful expression of recombinant Psilotum nudum Apocytochrome f, researchers should consider the following methodological approach:

  • Expression system selection: Bacterial expression systems (E. coli) are commonly used, but may require optimization of codon usage for plant-derived sequences. Alternative systems include yeast (P. pastoris) for better post-translational modifications or insect cell systems for membrane proteins.

  • Vector design: Incorporate appropriate tags (His, GST, or MBP) to facilitate purification while being mindful that the tag type should be determined during the production process to optimize protein yield and solubility .

  • Expression conditions:

    • Temperature: Lower temperatures (16-20°C) often improve folding

    • Induction: IPTG concentration (0.1-1.0 mM) and timing require optimization

    • Media: Rich media (like TB or 2YT) supplemented with heme precursors may enhance proper folding

  • Solubility considerations: Since Apocytochrome f is a membrane-associated protein, consider expressing the soluble domain without the membrane-spanning region, or use detergents (like DDM or CHAPS) in the lysis buffer when extracting the full-length protein.

Researchers should verify expression through SDS-PAGE and Western blot analysis using antibodies against either the protein itself or the incorporated tag.

What techniques are optimal for studying Apocytochrome f's role in photosynthetic electron transport?

Advanced studies of Apocytochrome f's role in photosynthetic electron transport require sophisticated biochemical and biophysical approaches:

  • Electron paramagnetic resonance (EPR) spectroscopy: This technique can directly measure the redox properties of the heme group within Apocytochrome f. Researchers should:

    • Prepare samples in appropriate buffers (typically 50 mM phosphate buffer, pH 7.0)

    • Measure signals at various redox states (oxidized/reduced)

    • Record spectra at low temperatures (typically 10-30K) for optimal signal resolution

  • Flash photolysis and stopped-flow spectroscopy: These methods enable measurement of electron transfer kinetics by:

    • Monitoring absorbance changes at wavelengths specific to Apocytochrome f (typically 550-554 nm)

    • Comparing wild-type protein with site-directed mutants to identify key residues

    • Correlating kinetic data with structural information

  • Reconstitution experiments: Incorporating purified Apocytochrome f into liposomes or nanodiscs allows researchers to:

    • Study the protein in a membrane-like environment

    • Measure vectorial electron transfer across membranes

    • Investigate interactions with other components of the photosynthetic apparatus

These methodologies provide complementary information about electron transfer pathways and can help elucidate the unique adaptations of Psilotum nudum's photosynthetic apparatus compared to other plant lineages.

How can researchers investigate evolutionary aspects of Psilotum nudum Apocytochrome f?

Evolutionary studies of Psilotum nudum Apocytochrome f require comparative analyses across multiple species using these methodological approaches:

  • Phylogenetic analysis:

    • Obtain petA sequences from diverse plant species, including other ferns, bryophytes, and seed plants

    • Perform multiple sequence alignments using MUSCLE or MAFFT algorithms

    • Construct phylogenetic trees using maximum likelihood or Bayesian methods

    • Identify conserved domains and lineage-specific adaptations

  • Molecular clock analyses:

    • Calibrate evolutionary rates using fossil evidence from fern lineages

    • Estimate divergence times for key evolutionary events in photosynthetic machinery

    • Compare rates of evolution between Psilotaceae and other plant families

  • Positive selection analysis:

    • Calculate dN/dS ratios across the protein sequence

    • Identify sites under positive selection using programs like PAML or HyPhy

    • Correlate selected sites with functional domains to infer adaptive significance

These approaches can reveal how Apocytochrome f has evolved in the unique context of Psilotum nudum's reduced morphology and can provide insights into the parallel evolution of photosynthetic proteins across plant lineages.

What analytical methods should be used to characterize post-translational modifications of the protein?

Characterizing post-translational modifications (PTMs) of Psilotum nudum Apocytochrome f requires multiple complementary techniques:

TechniqueApplicationSample PreparationData Analysis
Mass Spectrometry (LC-MS/MS)Identification of PTM sitesTryptic digestion, enrichment of modified peptidesDatabase search with variable modifications
PhosphoproteomicsDetection of phosphorylation sitesTiO₂ or IMAC enrichmentMotif analysis, kinase prediction
GlycoproteomicsAnalysis of glycosylation patternsPNGase F treatment, glycopeptide enrichmentGlycan structure determination
Western BlottingVerification of specific modificationsSDS-PAGE separation, transfer to membraneProbing with modification-specific antibodies
2D Gel ElectrophoresisSeparation of protein isoformsIEF followed by SDS-PAGEComparison of spot patterns

When analyzing PTMs, researchers should consider potential cross-talk between different modifications and their impact on protein function. For instance, phosphorylation may affect protein-protein interactions within the cytochrome b6f complex, while glycosylation patterns might influence protein stability or localization. Conservation analysis of modification sites across species can provide insights into their functional significance.

What purification strategies yield the highest purity of Recombinant Psilotum nudum Apocytochrome f?

Purifying Recombinant Psilotum nudum Apocytochrome f to high homogeneity requires a multi-step approach:

  • Initial capture:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged protein

    • Buffer composition: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, with imidazole gradient (10-250 mM)

    • Include mild detergents (0.05% DDM) if purifying the membrane-associated form

  • Intermediate purification:

    • Ion exchange chromatography (typically Q-Sepharose) to separate based on charge properties

    • Buffer: 20 mM Tris-HCl pH 7.5, with NaCl gradient (0-500 mM)

    • Monitor fractions by measuring absorbance at 280 nm (protein) and 410 nm (heme)

  • Polishing step:

    • Size exclusion chromatography (Superdex 75/200) to achieve final purity

    • Buffer: 20 mM HEPES pH 7.5, 150 mM NaCl, 5% glycerol

    • Analyze peak fractions by SDS-PAGE and spectroscopic methods

  • Quality control:

    • Purity assessment by SDS-PAGE (>95%)

    • Western blot confirmation

    • Spectroscopic analysis (A280/A410 ratio)

    • Mass spectrometry verification

For long-term storage, the purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage, avoiding repeated freeze-thaw cycles . Working aliquots can be stored at 4°C for up to one week.

How can researchers verify proper folding and functionality of the recombinant protein?

Verifying proper folding and functionality of Recombinant Psilotum nudum Apocytochrome f involves several complementary approaches:

  • Spectroscopic analysis:

    • UV-visible spectroscopy: Properly folded cytochrome f shows characteristic absorption peaks at ~554 nm (reduced) and ~410 nm (oxidized)

    • Circular dichroism (CD): Confirms secondary structure elements

    • Fluorescence spectroscopy: Monitors tertiary structure through intrinsic tryptophan fluorescence

  • Functional assays:

    • Redox potential measurements using potentiometric titrations

    • Electron transfer assays with physiological partners or artificial electron acceptors/donors

    • Binding studies with plastocyanin or other interaction partners using surface plasmon resonance

  • Thermal stability assessment:

    • Differential scanning calorimetry (DSC) to determine melting temperature

    • Thermal shift assays (Thermofluor) to screen stabilizing buffer conditions

  • Structural verification:

    • Limited proteolysis to assess compactness and domain organization

    • Small-angle X-ray scattering (SAXS) for solution structure

    • NMR spectroscopy for detailed structural information in solution

Researchers should compare the properties of the recombinant protein with those reported for native cytochrome f or homologous proteins from related species to establish proper folding and functionality.

What experimental design considerations are important when studying the protein's interaction with other components of the photosynthetic apparatus?

When designing experiments to study Psilotum nudum Apocytochrome f interactions with other photosynthetic components, researchers should consider:

  • Partner protein selection and preparation:

    • Purify potential interaction partners (plastocyanin, cytochrome b6) from Psilotum nudum or closely related species

    • Consider using isotope-labeled proteins for NMR studies

    • Verify the functional state of all proteins independently before interaction studies

  • Interaction detection methods:

    • Co-immunoprecipitation with antibodies against Apocytochrome f

    • Pull-down assays using tagged versions of partner proteins

    • Biolayer interferometry or surface plasmon resonance for kinetic and affinity measurements

    • Isothermal titration calorimetry for thermodynamic parameters

    • Chemical cross-linking followed by mass spectrometry for interaction interfaces

  • Physiologically relevant conditions:

    • Buffer composition mimicking thylakoid lumen (pH 5.5-6.5)

    • Ionic strength appropriate for chloroplast environment (100-200 mM)

    • Presence of relevant lipids or membrane mimetics

    • Redox control to simulate different photosynthetic states

  • Controls and validation:

    • Use known interaction partners as positive controls

    • Include non-interacting proteins as negative controls

    • Validate interactions using multiple orthogonal techniques

    • Confirm the specificity of interactions through competition experiments

This methodological framework ensures that the identified interactions are physiologically relevant and not artifacts of the experimental system.

How can Psilotum nudum Apocytochrome f be used in comparative studies of photosynthetic evolution?

Psilotum nudum Apocytochrome f serves as an excellent model for investigating photosynthetic evolution due to the unique phylogenetic position of whisk ferns. Research methodologies should include:

  • Comparative structural analysis:

    • Homology modeling based on crystal structures from other organisms

    • Identification of conserved vs. divergent regions across plant lineages

    • Mapping evolutionary changes onto functional domains

  • Functional comparison:

    • Cross-species electron transfer assays with plastocyanin from different plant groups

    • Measuring redox potentials across evolutionary lineages

    • Comparing kinetic parameters of electron transfer reactions

  • Chimeric protein construction:

    • Swapping domains between Apocytochrome f from different species

    • Testing functionality of hybrid proteins

    • Identifying domains responsible for species-specific characteristics

Psilotum nudum's position in the plant evolutionary tree makes its Apocytochrome f particularly valuable for understanding the evolution of photosynthetic electron transport chains across land plant diversification. The unusual morphology of Psilotum, with conducting tissues but lacking true leaves and roots, represents a reduction from more typical modern fern plants rather than the persistence of ancestral features, according to recent phylogenies . This evolutionary context makes comparative studies of its photosynthetic apparatus particularly informative.

What considerations are important when designing site-directed mutagenesis experiments for Psilotum nudum Apocytochrome f?

Site-directed mutagenesis of Psilotum nudum Apocytochrome f requires careful planning to yield meaningful functional insights:

  • Target selection:

    • Conserved residues identified through multiple sequence alignments

    • Residues in the CXXCH heme-binding motif

    • Charged residues potentially involved in protein-protein interactions

    • Residues identified from structural models as functionally important

  • Mutation strategy:

    • Conservative substitutions (e.g., Asp→Glu) to probe subtle effects

    • Non-conservative substitutions (e.g., Asp→Ala) to eliminate specific functionalities

    • Cysteine-to-serine mutations to disrupt heme binding

    • Introduction of non-natural amino acids for specialized biophysical studies

  • Experimental controls:

    • Multiple mutants at the same position with different substitutions

    • Reversion mutations to confirm causality

    • Double mutants to test compensatory effects

  • Comprehensive functional characterization:

    • Expression level and solubility assessment

    • Structural integrity verification

    • Heme incorporation efficiency

    • Redox potential measurements

    • Electron transfer kinetics

    • Binding affinity for interaction partners

This systematic approach enables researchers to establish structure-function relationships and identify critical residues for specific activities of Psilotum nudum Apocytochrome f.

How can metabolomic approaches complement proteomic studies of Psilotum nudum Apocytochrome f?

Integrating metabolomics with studies of Psilotum nudum Apocytochrome f can provide contextual insights into its function within the plant's broader biochemical network:

  • Correlation of metabolite profiles with protein expression:

    • Analyze changes in metabolite levels when Apocytochrome f is modified or disrupted

    • Focus on metabolites in photosynthetic pathways (sugars, ATP/ADP ratios)

    • Compare metabolite profiles across different tissues and developmental stages

  • Tissue-specific metabolite analysis:

    • Use MALDI-MS imaging to localize metabolites in Psilotum tissues

    • Compare with immunolocalization of Apocytochrome f

    • Correlate metabolite distribution with protein expression patterns

  • Stress response studies:

    • Monitor changes in both Apocytochrome f expression and metabolite profiles under various stresses

    • Analyze how altered electron transport affects downstream metabolism

    • Identify metabolic adaptations that compensate for electron transport perturbations

Psilotum nudum has a unique metabolic fingerprint across different organs, as demonstrated by Principal Component Analysis (PCA) of combined GC-MS and HPLC-QTOF-MS data . The specialized metabolites identified in Psilotum tissues, including arylpyrones and biflavonoids, may interact with or be influenced by the function of photosynthetic proteins like Apocytochrome f. Therefore, studying these metabolites in conjunction with protein analysis can provide a more comprehensive understanding of the plant's physiology.

What emerging technologies hold promise for advancing research on Psilotum nudum Apocytochrome f?

Emerging technologies that will likely enhance our understanding of Psilotum nudum Apocytochrome f include:

  • Cryo-electron microscopy (Cryo-EM):

    • Determination of high-resolution structures of the entire cytochrome b6f complex

    • Visualization of conformational changes during electron transfer

    • Structural basis for interaction with partner proteins

  • CRISPR-Cas9 genome editing:

    • Development of protocols for genetic manipulation of Psilotum nudum

    • Creation of knockout or modified petA genes to study function in vivo

    • Introduction of tags for live-cell imaging

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to measure distances between components

    • Optical tweezers to study mechanical properties of protein complexes

    • Single-molecule electron transfer measurements

  • Computational approaches:

    • Molecular dynamics simulations of protein motion in membrane environments

    • Quantum mechanical calculations of electron transfer pathways

    • Systems biology models incorporating Apocytochrome f function

These technologies will enable researchers to address fundamental questions about the structure, function, and evolution of Apocytochrome f in Psilotum nudum with unprecedented detail and precision.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.