Recombinant Psilotum nudum ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for prioritized development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Psilotum nudum (Whisk fern) (Lycopodium nudum)
Target Names
atpF
Target Protein Sequence
MINAINLPISLNNGPPAGGFGLNTNIFEINIINLGIVIGLLVYLGEGVLTNLLVNRKQTI LSTIRDAEERYREATDKLKQARARLQQAKVKAGEIRSNGLARMEREKQDLINAADEDSKR LEESKNSTIRFEEQRAIEQVRQQVSRLALERVLESLKSRFNSELHSRMIDYHIDLIKSME GTTD
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F1 domain and the membrane-embedded proton channel F0 domain, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.

This protein is a component of the F0 channel, forming part of the peripheral stalk that links F1 and F0.

Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What functional role does the atpF subunit play in the photosynthetic electron transport chain?

The atpF subunit is essential to the functioning of ATP synthase, which serves as the final complex in the photosynthetic electron transport chain. During photosynthesis, light energy drives electron transport through photosystem II, the cytochrome b6f complex, and photosystem I, creating a proton gradient across the thylakoid membrane. This proton gradient provides the motive force that ATP synthase uses to synthesize ATP .

The atpF (subunit b) specifically contributes to the stator stalk of ATP synthase, which holds the catalytic F₁ portion stationary against the rotational torque generated during ATP synthesis. This structural role is critical because it enables the enzyme to harness the energy of proton flow through the F₀ portion to drive the conformational changes in F₁ that lead to ATP production. Without the structural stability provided by atpF, the mechanical energy transduction would fail, disrupting the plant's ability to convert light energy into the chemical energy stored in ATP .

How is recombinant Psilotum nudum atpF typically expressed and purified for research purposes?

Recombinant Psilotum nudum atpF is typically expressed using prokaryotic expression systems like E. coli or eukaryotic systems such as yeast or baculovirus, depending on the research requirements. Standard recombinant protein technology involves:

  • Gene cloning: The atpF gene sequence is inserted into an appropriate expression vector

  • Host transformation: The vector is introduced into the chosen expression system

  • Protein expression: Culture conditions are optimized for protein production

  • Purification: Affinity chromatography techniques are employed using tags such as His-tags

For Psilotum nudum atpF specifically, the protein is often supplied in a Tris-based buffer with 50% glycerol for stability, and researchers are advised to store it at -20°C for short-term use or -80°C for extended storage. Working aliquots may be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can affect protein integrity .

What techniques are most effective for studying the interaction between atpF and other subunits of the ATP synthase complex?

High-throughput in vivo protein photo-cross-linking analysis has emerged as a particularly effective technique for studying interactions between ATP synthase subunits. This approach involves:

  • Site-directed mutagenesis: Introduction of unnatural amino acids at specific sites in the atpF protein through scarless genome-targeted site-directed mutagenesis

  • Photo-cross-linking: UV-induced formation of covalent bonds between closely associated proteins

  • Analysis of cross-linked products: Using high-throughput polyacrylamide gel electrophoresis (PAGE) to identify interaction partners

This methodology has been successfully employed to study conformational changes in ATP synthase subunits and could be applied specifically to investigate atpF interactions with other components of the complex. The technique is particularly valuable because it allows for the examination of protein-protein interactions under various physiological conditions, thereby providing insights into how environmental factors affect ATP synthase function .

How do post-translational modifications affect the function of atpF in Psilotum nudum chloroplasts?

Post-translational modifications (PTMs) of atpF can significantly alter its function within the ATP synthase complex. While specific PTM data for Psilotum nudum atpF is limited in the provided search results, methodological approaches to studying these modifications include:

  • Mass spectrometry-based proteomics: Techniques like LC-MS/MS can identify phosphorylation, acetylation, and other modifications

  • Site-directed mutagenesis: Replacing potential modification sites with non-modifiable amino acids to assess functional impacts

  • Biotinylation assays: Similar to the AviTag-BirA technology mentioned for the epsilon chain, specific residues in atpF can be tagged to study their accessibility and role in protein-protein interactions

Research indicates that PTMs might regulate the assembly of ATP synthase and its adaptation to different environmental conditions. For example, phosphorylation of specific residues might affect the binding affinity between atpF and other subunits, potentially influencing the efficiency of ATP synthesis under stress conditions.

What is known about the evolutionary conservation of atpF across photosynthetic organisms compared to Psilotum nudum?

Psilotum nudum, as a whisk fern, occupies an interesting evolutionary position as one of the earliest vascular plants. Comparative analysis of atpF across photosynthetic organisms reveals:

  • High sequence conservation: The core structural elements of atpF are highly conserved across photosynthetic organisms, reflecting the fundamental importance of ATP synthase in energy metabolism

  • Differential evolution rates: While the transmembrane regions show high conservation, connecting loops and termini may exhibit species-specific variations

  • Evolutionary adaptations: Modifications in specific regions of atpF may correlate with adaptation to different environmental niches

Methodological approaches to evolutionary analysis include:

  • Multiple sequence alignment (MSA) of atpF homologs across diverse photosynthetic species

  • Phylogenetic tree construction to visualize evolutionary relationships

  • Calculation of selection pressure (dN/dS ratios) on different regions of the protein

  • Structural modeling to correlate sequence conservation with functional domains

By comparing Psilotum nudum atpF with homologs from other photosynthetic organisms, researchers can identify highly conserved residues that are likely essential for function, as well as unique features that may contribute to species-specific adaptations .

What are the optimal storage and handling conditions for maintaining the stability of recombinant Psilotum nudum atpF for long-term research?

Maintaining the stability and activity of recombinant Psilotum nudum atpF requires careful attention to storage and handling conditions:

Storage ParameterRecommended ConditionNotes
Short-term storage-20°CSuitable for periods up to several months
Long-term storage-80°CRecommended for maintaining stability beyond several months
Buffer compositionTris-based buffer with 50% glycerolOptimized for this specific protein
Working aliquots4°CMaintain for no more than one week
Freeze-thaw cyclesMinimizeEach cycle can reduce protein activity by 10-30%

For experimental protocols requiring repeated use, it is advisable to prepare multiple small aliquots during initial storage to avoid repeated freeze-thaw cycles. The addition of protease inhibitors may also be beneficial when working with the protein over extended periods .

How can functional assays be designed to measure the specific contribution of atpF to ATP synthase activity in Psilotum nudum?

Designing functional assays to measure the specific contribution of atpF requires isolating its effects from those of other ATP synthase components. Several methodological approaches include:

  • Reconstitution experiments: Incorporating purified recombinant atpF into artificial membrane systems or atpF-depleted ATP synthase complexes to restore function

  • Site-directed mutagenesis: Creating specific mutations in key functional regions of atpF to assess their impact on ATP synthesis

  • ATP synthesis assays: Measuring ATP production rates using luciferin/luciferase bioluminescence assays under various conditions

  • Proton translocation measurements: Assessing how atpF variants affect proton flow through the F₀ sector using pH-sensitive fluorescent dyes

A comprehensive experimental design might involve:

  • Expression of wild-type and mutant forms of atpF

  • Incorporation into liposomes containing other ATP synthase components

  • Measurement of ATP synthesis rates under standardized conditions

  • Correlation of activity with structural features of atpF variants

What analytical techniques are most suitable for examining the membrane insertion and topology of atpF in chloroplast thylakoid membranes?

Understanding the membrane insertion and topology of atpF in chloroplast thylakoid membranes requires specialized analytical techniques:

  • Protease protection assays: Treatment of isolated thylakoid membranes with proteases to determine which portions of atpF are accessible

  • Chemical labeling: Using membrane-impermeable reagents to identify exposed regions of the protein

  • Fluorescence resonance energy transfer (FRET): Tagging specific domains to measure distances between protein regions

  • Cryo-electron microscopy: Visualizing the structure of atpF within the intact ATP synthase complex

A methodological workflow might include:

  • Isolation of intact chloroplasts from Psilotum nudum tissue

  • Fractionation to obtain purified thylakoid membranes

  • Application of topology-probing techniques

  • Integration of results to build a comprehensive topological model

These approaches can reveal how atpF spans the thylakoid membrane and how its orientation contributes to ATP synthase function. Understanding this topology is crucial for interpreting how mutations or modifications affect protein function .

How can studies of Psilotum nudum atpF contribute to understanding evolutionary adaptations in photosynthetic efficiency?

Psilotum nudum represents an evolutionarily significant lineage as one of the earliest vascular plants, making its ATP synthase components valuable for evolutionary studies. Research methodologies in this area include:

  • Comparative genomics: Analyzing atpF sequences across photosynthetic organisms from various evolutionary lineages

  • Functional complementation: Testing whether Psilotum nudum atpF can functionally replace homologs in other species

  • Biochemical characterization: Comparing enzymatic properties of ATP synthase containing atpF from different evolutionary lineages

  • Structural biology: Resolving structures of ATP synthase components to identify adaptive changes

By examining the unique features of Psilotum nudum atpF compared to those of other photosynthetic organisms, researchers can identify molecular adaptations that may correlate with photosynthetic efficiency under different environmental conditions. This research has implications for understanding how photosynthesis evolved and adapted across plant lineages .

What insights can metabolomic analysis provide about the relationship between ATP synthase function and metabolite profiles in Psilotum nudum?

Metabolomic analysis can reveal connections between ATP synthase function and broader metabolic networks in Psilotum nudum. Principal Component Analysis (PCA) of GC-MS and HPLC-QTOF-MS data has already demonstrated distinct metabolite profiles in different Psilotum organs and tissues . To investigate the specific relationship with ATP synthase function:

  • Comparative metabolomics: Analyze metabolite profiles in wild-type versus ATP synthase-modified Psilotum tissues

  • Flux analysis: Use isotope labeling to track carbon flow through metabolic pathways

  • Correlation studies: Relate ATP/ADP ratios with specific metabolite concentrations

  • Integrative systems biology: Combine metabolomic, transcriptomic, and proteomic data to model energy metabolism networks

These approaches can help identify metabolic signatures associated with altered ATP synthase function and reveal how energy metabolism is integrated with other aspects of plant physiology. The unique position of Psilotum in plant evolution makes these studies particularly valuable for understanding the co-evolution of energy metabolism and specialized metabolic pathways .

How might advanced genetic engineering techniques be applied to study atpF function in Psilotum nudum chloroplasts?

Advanced genetic engineering techniques offer powerful approaches to study atpF function in Psilotum nudum:

  • Chloroplast transformation: Similar to techniques used in tobacco, chloroplast genome engineering could create atpF variants or knockout mutants in Psilotum

  • CRISPR-Cas9 technology: While more challenging in organelles, modified CRISPR systems could potentially target chloroplast genes

  • Inducible expression systems: Creating systems where atpF expression can be controlled temporally to study assembly processes

  • Synthetic biology approaches: Designing minimal or modified ATP synthase complexes to test functional hypotheses

Methodological considerations include:

  • Development of tissue culture and transformation protocols specific to Psilotum nudum

  • Optimization of selection markers for chloroplast transformation

  • Design of constructs that can integrate at the appropriate genomic loci

  • Validation of transformed lines using molecular and functional assays

These genetic engineering approaches would enable researchers to dissect the function of atpF in vivo and understand its contribution to ATP synthase assembly, stability, and activity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.