Recombinant Psilotum nudum Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics

cemA is a full-length recombinant protein derived from Psilotum nudum, a vascular plant belonging to the Psilotaceae family. Key details include:

ParameterDetails
UniProt IDQ8WI08
Length449 amino acids (AA)
Expression HostEscherichia coli (full-length expression)
TagVariable (determined during production)
Storage BufferTris-based buffer, 50% glycerol, pH optimized
Purity>90% (as determined by SDS-PAGE)

Amino Acid Sequence Highlights
The protein sequence includes conserved regions critical for membrane localization and potential interactions:

  • N-Terminal Region: MNMELNNSVFLIYWSLLECKFS... (membrane-anchoring motifs)

  • Central Regions: Includes hydrophobic stretches (e.g., IVLVIIGKKRLAVSNSWIQE) and hydrophilic segments (e.g., SSKWVLEPRIKDWWNTSQFQIFINHLQE)

  • C-Terminal Region: ...FVSTFPVI LDTVFKYWIFRHLNRLSPSIVATYHTMNE (possible interaction domains)

Production and Purification

The recombinant protein is synthesized in E. coli and purified using standard protocols:

StepDetails
Expression SystemE. coli (full-length cemA)
TaggingN-terminal His-tag (optional, as per production process)
PurificationAffinity chromatography (His-tag) or size-exclusion chromatography
Storage-20°C or -80°C in Tris/PBS buffer with 6% trehalose

Key Challenges

  • Solubility: Recombinant proteins from E. coli often require refolding or optimization of expression conditions .

  • Stability: Repeated freeze-thaw cycles degrade activity; aliquots should be stored at 4°C for short-term use .

Genomic Context and Evolutionary Insights

cemA is encoded in the plastid genome of P. nudum. Notably, its genomic organization reflects evolutionary adaptations:

Genomic FeatureDescription
Plastid Genome Size~142,888 bp (comparable to other ferns) .
Inverted Repeat (IR) RegionsExpanded IR regions in P. nudum incorporate genes like rps12 and rps7 .
Gene DuplicationPossible duplication events influencing cemA evolution in Psilotaceae .

Evolutionary Significance

  • IR Expansion: In P. nudum, the IR region has incorporated genes such as rps12 and rps7, potentially stabilizing genome structure .

  • Conservation: cemA homologs in other plants (e.g., Nephroselmis olivacea) share structural motifs, suggesting conserved functions .

Research Gaps and Future Directions

AreaOpportunities for Study
Functional StudiesKnockout mutants in P. nudum to assess cemA’s role in chloroplast biogenesis.
Interactome AnalysisYeast two-hybrid or co-IP to identify cemA-binding partners.
Phylogenetic AnalysisComparative studies across ferns and seed plants to trace cemA’s origins.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-449
Protein Length
full length protein
Species
Psilotum nudum (Whisk fern) (Lycopodium nudum)
Target Names
cemA
Target Protein Sequence
MNMELNNSVFLIYWSLLECKFSIFVLNFWNRWKHILLYKFSSPISIYNHLSSRSKNRISS REYFFNMNIRDPILNTYFYLSFLFERIGLKKDEDVGKLKRNRIFDIFDERSKENRLVYAV KYMSKKSNNREKMNRRLAWIETTLNDLRICKKYFYNFPFSVEIKDRLDEELSISKSIELT VPTTIAYESINIVPRSITRTLSRFKAELIGQSSSLVLHEFKLAKYQALASLRYMGCLLFL PFFISSISKKWVLEPRIKDWWNTSQFQIFINHLQEKKALKRLQDVEELLWLDRIILEEDH SKDLSIKIREKTVQLVAIYNEDSIQIILNLLTDIISFTILSVLVIIGKKRLAVSNSWIQE LFHSLSDTMKAFFILLLTDLFIGFHSPHGWEIIIGSILEHIGFAYDKYTISYFVSTFPVI LDTVFKYWIFRHLNRLSPSIVATYHTMNE
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

Experimental Design for Recombinant cemA Production

Q: How should I design experiments to optimize recombinant cemA expression in heterologous systems?

A: Optimal expression requires systematic testing of variables across host systems, vector designs, and culture conditions. For bacterial systems (e.g., E. coli), prioritize codon optimization for Psilotum nudum sequences, as chloroplast proteins often have GC-rich regions that may mismatch with bacterial codon usage. Use vectors with inducible promoters (e.g., T7 RNA polymerase-driven systems) to control expression timing. For eukaryotic systems (e.g., insect cells or plant-based platforms), consider chloroplast-targeting sequences to ensure proper localization .

Key Variables to Test:

VariableBacterial SystemsEukaryotic Systems
InductionIPTG concentration, temperatureTime post-infection (e.g., baculovirus)
SolubilityChaperone co-expression (GroEL/ES)Secretion signal peptides
PurificationAffinity tags (His-tag, GST)Epitope tags (FLAG, HA)

Critical Considerations:

  • Protein folding: Chloroplast envelope proteins often require membrane integration. Use detergents (e.g., DDM) to solubilize inclusion bodies in bacterial systems.

  • Post-translational modifications: Unlike bacterial systems, eukaryotic hosts may add glycosylation, which may alter cemA function.

Resolving Data Contradictions in cemA Functional Studies

Q: How do I address discrepancies in functional assays (e.g., membrane integration vs. soluble expression)?

A: Discrepancies often arise from incomplete solubilization or mislocalization. Use orthogonal methods to validate results:

  • Western blotting: Detect full-length cemA with antibodies against epitope tags.

  • Mass spectrometry: Confirm protein identity and exclude degradation products.

  • Membrane fractionation: Isolate chloroplast membranes (if using plant systems) or bacterial inner membranes to assess localization.

Example Workflow:

  • Solubility screening: Test fractions (pellet vs. supernatant) after lysis for cemA presence.

  • Protease sensitivity: Treat membrane fractions with trypsin to assess surface exposure.

  • Structural analysis: Use cryo-EM or NMR to confirm tertiary structure in native-like environments.

Advanced Purification Strategies for cemA

Q: What advanced chromatography methods are recommended for high-purity cemA?

A: For recombinant cemA, prioritize multistep purification to remove contaminants while preserving activity:

  • IMAC (Immobilized Metal Affinity Chromatography): Capture His-tagged cemA using Ni-NTA resin.

  • Size-exclusion chromatography (SEC): Separate monomeric cemA from aggregates.

  • Ion-exchange chromatography (IEC): Further refine purity based on protein charge.

Purification Challenges:

ChallengeSolution
Membrane protein aggregationUse mild detergents (e.g., Fos-choline) during elution.
Host protein contaminationIncorporate protease inhibitors (e.g., PMSF) during lysis.

Functional Characterization of cemA in Chloroplast Envelope

Q: How can I study cemA’s role in chloroplast envelope membrane dynamics?

A: Functional studies require in vivo and in vitro approaches:

  • Biochemical assays:

    • Lipid binding: Use lipid vesicle assays to test cemA’s interaction with chloroplast membrane lipids (e.g., monogalactosyldiacylglycerol).

    • Protein-protein interactions: Co-IP or yeast two-hybrid to identify binding partners (e.g., ATP synthase subunits).

  • Structural analysis:

    • Cryo-EM: Resolve cemA’s structure in lipid bilayers.

    • Cross-linking mass spectrometry: Map interaction sites with envelope proteins.

Example Experimental Design:

ApproachMethodologyExpected Outcome
Membrane integrationBiophysical assays (e.g., tryptophan fluorescence quenching)Confirm transmembrane topology.
Enzymatic activityATPase activity assays (if cemA regulates ATP synthase)Link cemA to energy transfer processes.

Addressing Low Expression Yields

Q: Why might recombinant cemA expression be inefficient, and how to improve it?

A: Low yields often stem from incompatible codon usage, insufficient solubility, or inadequate induction. Implement the following optimizations:

  • Codon optimization: Use tools like GeneOptimizer® to align Psilotum nudum codons with the host’s usage bias.

  • Chaperone co-expression: In bacterial systems, express GroEL/GroES to assist folding.

  • Cold-shock induction: Reduce growth temperature post-induction (e.g., 16–18°C) to slow protein synthesis and improve solubility.

Case Study:
A study on a homologous chloroplast protein (e.g., Chlamydomonas cemA) achieved >5 mg/L yields in E. coli using a pET-28a vector with T7 promoter, optimized codons, and co-expression of GroEL .

Contradictions in Literature: Chloroplast vs. Nucleus Localization

Q: How to resolve conflicting reports about cemA’s localization (chloroplast vs. nuclear-encoded)?

A: Discrepancies may arise from species-specific differences or methodological artifacts. Validate using:

  • Genomic analysis: Confirm cemA’s presence in Psilotum nudum chloroplast genome via sequencing.

  • Transcript localization: Perform RNA FISH to detect cemA mRNA in chloroplasts vs. nucleus.

  • Protein targeting signals: Predict chloroplast transit peptides (cTPs) using tools like ChloroP.

Example Contradiction Resolution:
In Chlamydomonas, cemA is part of a polycistronic operon with atpA and psbI, suggesting chloroplast localization . For Psilotum, verify via Southern blot of chloroplast DNA.

Stability of Recombinant cemA

Q: How to stabilize recombinant cemA for long-term storage?

A: Stabilization requires buffer optimization and preservative additives:

  • Buffer components: Use 50 mM Tris (pH 8.0), 150 mM NaCl, 1 mM DTT (to prevent oxidation).

  • Cryoprotectants: Add 10% glycerol for −80°C storage.

  • Lipid supplementation: For membrane proteins, incorporate phospholipids (e.g., E. coli lipid extract) to mimic native environments.

Stability Metrics:

ParameterLow Stability (Problematic)High Stability (Desirable)
Aggregation>20% insoluble fraction<5% insoluble fraction
Activity loss>50% over 1 month at 4°C<10% over 6 months at −80°C

Data Analysis for Structural Studies

Q: How to interpret cryo-EM data for cemA’s membrane integration?

A: Structural validation requires multi-resolution analysis:

  • Class 2D averages: Confirm consistent particle orientations.

  • 3D reconstruction: Use symmetry constraints (e.g., C1 for single particles).

  • Membrane density fitting: Superimpose cemA’s structure onto chloroplast envelope membrane models.

Common Pitfalls:

  • Over-fitting: Use cross-validation (e.g., half-map) to prevent model bias.

  • Signal loss: Optimize contrast transfer function (CTF) correction for low-dose imaging.

Species-Specific Challenges in Psilotum nudum

Q: What unique challenges exist when working with Psilotum nudum compared to model organisms?

A: Psilotum lacks robust genetic tools, necessitating heterologous systems for cemA studies. Key hurdles include:

  • Limited genomic resources: Use transcriptomics to annotate chloroplast genes.

  • Low transformation efficiency: Optimize Agrobacterium-mediated transformation for Psilotum.

  • Spore-based propagation: Ensure spore viability during gene editing.

Mitigation Strategies:

ChallengeSolution
Lack of cDNA librariesUse RNA-seq to predict cemA transcript.
Spore dormancyTreat spores with 1% H2O2 to enhance germination.

Ethical and Biosafety Considerations

Q: What biosafety protocols are required for recombinant cemA work?

A: Follow Biosafety Level 1 (BSL-1) guidelines for non-pathogenic hosts (e.g., E. coli), but escalate to BSL-2 for insect cell systems. Key measures:

  • Waste disposal: Autoclave cultures and chromatography buffers.

  • Personal protective equipment (PPE): Lab coats, gloves, and eye protection during centrifugation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.