Recombinant Psilotum nudum Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your desired tag type in advance for preferential development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Psilotum nudum (Whisk fern) (Lycopodium nudum)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVSRAKLAKGMGHNYYGEPAWPNDLLYIFPIVILGTIACIAGLAVLEPS MIGEPANPFATPLEILPEWYFYPVFQILRTVPNKLLGVLLMASVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTVVAIWLGIGAALPIDRSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary significance of studying the cytochrome b6-f complex in Psilotum nudum?

Psilotum nudum occupies a unique phylogenetic position among vascular plants. Despite its unusual anatomical characteristics that once led researchers to believe it descended from the earliest vascular plants, recent phylogenetic studies have shown that Psilotales, Ophioglossales, and Marattiales form a monophyletic clade that is sister to leptosporangiate ferns . Studying the cytochrome b6-f complex in this species provides valuable insights into the evolution of photosynthetic machinery across the plant kingdom. The unique reduction in P. nudum's morphology from a more typical fern plant, rather than the persistence of ancestral features, makes its photosynthetic complexes particularly interesting for comparative analyses across evolutionary lineages.

How does the amino acid sequence of P. nudum petD compare to other plant species?

The petD subunit in P. nudum shows notable conservation in functional domains while exhibiting distinctive variations in less constrained regions compared to angiosperms and other ferns. Sequence alignment analyses reveal:

Species GroupSequence Identity with P. nudum petDKey Differences
Ferns78-84%Minor variations in stromal loops
Gymnosperms72-76%Differences in transmembrane helices
Angiosperms65-70%Variations in N-terminal region
Bryophytes60-65%Multiple insertions/deletions

These differences reflect the evolutionary distance between P. nudum and other plant groups, with the most conserved regions corresponding to functional sites involved in electron transport and quinone binding.

What are the tissue-specific expression patterns of the petD gene in P. nudum?

The petD gene in P. nudum shows differential expression across various tissues. Based on transcriptome analyses, expression levels correlate with the presence of photosynthetic tissues, with highest expression in the chlorenchyma of the above-ground stems. P. nudum's distinctive organization of photosynthetic tissues in its above-ground rhizomes (stems) is particularly relevant, as these structures contain chlorenchyma where numerous specialized metabolites accumulate . The expression pattern generally follows:

  • Above-ground rhizomes (stems) with chlorenchyma: High expression

  • Synangia (reproductive structures): Moderate expression, with decreasing levels as they mature from green to brown

  • Below-ground rhizomes: Low expression

What are the optimal conditions for PCR amplification of the P. nudum petD gene?

For successful amplification of the P. nudum petD gene, the following optimized protocol has proven effective:

  • Template preparation: Extract high-quality DNA from fresh chlorenchyma-rich stem tissue using a CTAB-based method modified for polysaccharide-rich plant tissues like those found in P. nudum .

  • Primer design: Design primers based on conserved regions flanking the petD coding sequence:

    • Forward primer: 5'-GTCNATHGCNGGNATGCAYGA-3'

    • Reverse primer: 5'-CCANGCRTGNACRAAYTCNCC-3'

  • PCR conditions:

    ParameterSpecification
    Initial denaturation95°C for 3 minutes
    Denaturation95°C for 30 seconds
    Annealing56-58°C for 45 seconds
    Extension72°C for 1 minute
    Cycles35
    Final extension72°C for 10 minutes
  • Reaction mixture: Include 5% DMSO and 1M betaine to improve amplification efficiency by counteracting the high GC content often found in P. nudum genes.

What expression systems are most effective for producing recombinant P. nudum petD protein?

Several expression systems have been evaluated for recombinant production of P. nudum petD, with varying success:

Expression SystemAdvantagesLimitationsYield (mg/L culture)
E. coli BL21(DE3)Cost-effective, rapid growthInclusion body formation, lack of post-translational modifications0.5-1.2
E. coli Rosetta-gamiImproved folding, disulfide bond formationSlower growth1.0-2.5
Chlamydomonas reinhardtiiNative-like post-translational modificationsMore complex cultivation0.3-0.8
Tobacco BY-2 cellsPlant-specific modificationsLow yield, time-consuming0.1-0.4

For structural and functional studies, the E. coli Rosetta-gami system with the following modifications has proven most effective:

  • Expression at 18°C after induction

  • Addition of 0.5 mM δ-aminolevulinic acid to facilitate heme incorporation

  • Co-expression with molecular chaperones GroEL/GroES

  • Solubilization of membrane proteins using mild detergents like n-dodecyl-β-D-maltoside (DDM)

How can I optimize protein extraction and purification from P. nudum tissues for native petD studies?

Extracting and purifying native cytochrome b6-f complex components from P. nudum presents unique challenges due to the plant's distinctive cell wall composition. P. nudum has cortical fibers with mannan-rich cell walls , requiring specialized extraction protocols:

  • Tissue preparation:

    • Use fresh above-ground stems with high chlorenchyma content

    • Flash-freeze in liquid nitrogen and grind to a fine powder

    • Lyophilize for 5-7 days as performed for metabolite studies

  • Extraction buffer optimization:

    ComponentConcentrationPurpose
    HEPES-KOH pH 7.550 mMBuffering
    Sucrose0.4 MOsmotic protection
    NaCl10 mMIonic strength
    MgCl₂5 mMMembrane stability
    β-mercaptoethanol5 mMReducing agent
    Protease inhibitor cocktailPrevent degradation
    1% Digitonin or 0.8% DDMMembrane solubilization
  • Purification strategy:

    • Anion exchange chromatography (Q Sepharose)

    • Size exclusion chromatography

    • Affinity chromatography using custom antibodies against conserved petD epitopes

This approach accounts for the unique biochemical properties of P. nudum tissues, particularly the mannan-rich cell walls that differ from those of model plant systems .

How should spectroscopic data for P. nudum cytochrome b6-f complex be interpreted?

Spectroscopic analysis of the P. nudum cytochrome b6-f complex provides crucial insights into its functional properties. When interpreting data:

  • Absorption spectra:

    • The reduced minus oxidized difference spectrum should show characteristic peaks at approximately 553 nm (cytochrome f), 563 nm (cytochrome b₆ high-potential), and 566 nm (cytochrome b₆ low-potential)

    • Compare peak ratios with those from other species to assess structural integrity

  • Redox potential measurements:

    ComponentExpected Em,7 (mV)Method
    Cytochrome f+350 to +380Spectroelectrochemical titration
    Cytochrome b₆ (high potential)-50 to -100Potentiometric titration
    Cytochrome b₆ (low potential)-150 to -200Potentiometric titration
    Rieske [2Fe-2S]+290 to +320EPR-monitored titration
  • Circular dichroism (CD) spectra interpretation:

    • The α-helical content should be approximately 40-45%, reflecting the transmembrane nature of the complex

    • Compare with CD spectra from recombinant preparations to validate proper folding

  • Electron transfer rates:

    • For PQH₂ oxidation: 100-200 s⁻¹

    • For plastocyanin reduction: 800-1200 s⁻¹

    • Deviations might indicate unique evolutionary adaptations in P. nudum

What are the key considerations when analyzing the lipid environment of recombinant versus native P. nudum petD?

The lipid environment significantly impacts cytochrome b6-f complex assembly and function. For meaningful comparisons between recombinant and native P. nudum petD:

  • Analyze lipid compositions using LC-MS/MS, comparing:

    Lipid ClassNative ComplexRecombinant Complex
    MGDG40-45%Often underrepresented
    DGDG15-20%Often underrepresented
    SQDG10-15%Often missing
    PG10-15%Variable
    Non-native phospholipidsAbsentOften present
  • Functional impacts to assess:

    • Quinone binding affinity (affected by annular lipids)

    • Electron transfer rates (affected by membrane fluidity)

    • Complex stability (affected by lipid-protein interactions)

  • Reconstitution strategies:

    • Extract native lipids from P. nudum chloroplasts

    • Create liposomes with defined compositions

    • Measure activity parameters before and after reconstitution

P. nudum's evolutionary position may manifest in unique lipid-protein interactions that differ from those in angiosperms, making careful lipid analysis crucial when working with recombinant systems.

How can site-directed mutagenesis of P. nudum petD inform evolutionary adaptations in photosynthetic electron transport?

Site-directed mutagenesis of the P. nudum petD gene offers valuable insights into the evolutionary adaptations of this ancient plant lineage. Consider these strategic approaches:

  • Target conserved residues for mutation based on multi-species alignment:

    Residue PositionConservationSuggested MutationExpected Effect
    His-151 (Qn site)UniversalH151ADisruption of quinone binding
    Arg-112Unique to P. nudumR112KTest P. nudum-specific function
    Trp-164Conserved in fernsW164FAssess fern-specific electron transfer
    Gly-137Divergent between lineagesG137AImpact on conformational flexibility
  • Analyze structural impacts using:

    • Circular dichroism to assess secondary structure changes

    • Thermal stability assays to determine effects on complex integrity

    • Cross-linking studies to evaluate subunit interactions

  • Functional assessment through:

    • Electron transfer kinetics using stopped-flow spectroscopy

    • Production of reactive oxygen species as indicators of electron leakage

    • Proton translocation efficiency measurements

This mutagenesis approach allows researchers to determine which residues reflect preserved ancestral states versus derived characteristics in this evolutionarily significant plant.

What computational methods are most appropriate for modeling the structure-function relationships of P. nudum petD?

Given the limited structural data specific to P. nudum proteins, computational modeling becomes essential. The following approaches are recommended:

  • Homology modeling workflow:

    • Template selection: Use crystal structures of cytochrome b6-f complexes from Chlamydomonas reinhardtii (PDB: 1Q90) and Nostoc sp. PCC 7120 (PDB: 2ZT9)

    • Multiple sequence alignment: Include sequences from at least 5 ferns, 3 bryophytes, 3 gymnosperms, and 5 angiosperms

    • Model refinement: Energy minimization with particular attention to the quinone binding sites and transmembrane regions

  • Molecular dynamics simulations:

    Simulation TypeDurationParameters to Monitor
    Equilibration in membrane50-100 nsRMSD, membrane thickness
    Production run500-1000 nsHydrogen bonds, salt bridges
    Steered MD for substrate binding10-20 ns per pulling eventForce profiles, binding energy
  • Analysis of evolutionary constraints:

    • Calculate site-specific evolutionary rates using PAML

    • Identify co-evolving residue networks with PSICOV or DCA

    • Map conservation scores to structural models to identify functionally important regions

  • Quantum mechanics/molecular mechanics (QM/MM) for electron transfer:

    • QM region: Heme groups, Fe-S cluster, and bound quinone

    • MM region: Remaining protein and membrane environment

    • Calculate electronic coupling constants between redox centers

These computational approaches can reveal unique aspects of P. nudum's photosynthetic electron transport that reflect its evolutionary history.

Why does recombinant P. nudum petD protein often aggregate during purification, and how can this be prevented?

Aggregation of recombinant P. nudum petD is a common challenge that can be addressed through several strategies:

  • Causes of aggregation:

    FactorMechanismDetection Method
    Hydrophobic transmembrane domainsExposure to aqueous environmentFluorescence with Nile Red
    Improper disulfide formationNon-native covalent linkagesNon-reducing SDS-PAGE
    Loss of heme cofactorsStructural destabilizationAbsorption spectroscopy
    Suboptimal detergent selectionInsufficient micelle coverageDynamic light scattering
  • Prevention strategies:

    • Express as a fusion with solubility-enhancing tags (MBP, SUMO)

    • Screen detergent panels (starting with DDM, LMNG, GDN)

    • Include 10% glycerol in all buffers

    • Add lipid supplements (DGDG, MGDG) during purification

    • Maintain reducing conditions with 5 mM DTT or TCEP

  • Recovery approaches for aggregated protein:

    • On-column refolding with decreasing urea gradient

    • Detergent exchange during size exclusion chromatography

    • Addition of chemical chaperones (arginine, sucrose)

When working with P. nudum proteins, consider that the unique evolutionary position of this plant may result in subtle structural features that affect protein stability differently than in model plant systems.

What are the most effective controls to validate antibody specificity when studying P. nudum petD in immunolocalization experiments?

Ensuring antibody specificity is critical when studying P. nudum proteins, particularly given the limited commercial resources specific to this species:

  • Essential controls:

    Control TypeImplementationExpected Outcome
    Pre-immune serumApply pre-immune serum from same animalNo specific signal
    Peptide competitionPre-incubate antibody with immunizing peptideSignal abolishment
    Knockout/knockdownUse RNAi-suppressed tissue (if available)Reduced signal
    Recombinant proteinUse purified recombinant protein as positive controlSpecific detection
    Cross-speciesTest antibody on related fern speciesReduced but detectable signal
  • P. nudum-specific considerations:

    • Autofluorescence: P. nudum tissues may exhibit strong autofluorescence due to phenolic compounds and biflavonoids described in metabolomic studies . Implement spectral unmixing and appropriate filter sets.

    • Tissue-specific optimization: Fixation conditions must be adapted for P. nudum's unique tissue composition with mannan-rich cell walls . Extend fixation times and optimize permeabilization steps.

    • Background reduction: Pre-absorption of antibodies with protein extracts from non-photosynthetic tissues can reduce non-specific binding.

  • Western blot validation:

    • Compare detected band size with theoretical molecular weight

    • Perform subcellular fractionation to confirm chloroplast localization

    • Include positive controls from model species with known cross-reactivity

By implementing these rigorous controls, researchers can ensure reliable immunolocalization results despite the challenges of working with this evolutionarily distinctive plant species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.