Recombinant Psilotum nudum NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Psilotum nudum NAD(P)H-quinone Oxidoreductase Subunit 3, Chloroplastic (ndhC)

Recombinant Psilotum nudum NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) is a protein involved in the electron transport chain within the chloroplasts of plants, specifically in Psilotum nudum, also known as the whisk fern . This protein is a subunit of the NAD(P)H dehydrogenase complex, which plays a role in various photosynthetic processes .

Function and Role

The primary function of the ndhC subunit is to shuttle electrons from NAD(P)H to plastoquinone, utilizing FMN and iron-sulfur centers to facilitate this transfer . This process is crucial for:

Association with Chloroplast Lipid Droplets

The NAD(P)H dehydrogenase C1 (NDC1) is found to associate with plastoglobules, a type of chloroplast lipid droplet . NDC1 reduces a plastoquinone analog in vitro and influences the redox state of the plastoquinone pool by reducing the plastoquinone reservoir of plastoglobules .

Experimental Evidences

  • In Vitro Activity: Recombinant NDC1 can utilize decyl-PQ as a substrate with NADPH as the electron donor . Purified plastoglobules can function as a quinone-containing substrate, accepting electrons from NADPH and recombinant NDC1 in vitro .

  • In Vivo Impact: Mutants lacking NDC1 exhibit a more oxidized plastoquinone pool compared to wild-type plants . NDC1 is essential for normal plastochromanol-8 accumulation and vitamin K1 production .

Potential Applications

Understanding the function and structure of ndhC can have implications for:

  • Crop Improvement: Enhancing photosynthetic efficiency and stress tolerance in plants .

  • Biotechnology: Engineering plants for improved production of valuable compounds such as vitamins and antioxidants .

Data Table

PropertyDescription
Protein NameNAD(P)H-quinone oxidoreductase subunit 3, chloroplastic
OrganismPsilotum nudum (Whisk fern)
FunctionShuttles electrons from NAD(P)H to plastoquinone, couples redox reactions to proton translocation
Subcellular LocalizationChloroplast
Related ComplexNAD(P)H dehydrogenase complex
In vitro activityCan utilize quinone analogs as substrates with NADPH as an electron donor
In vivo impactInfluences the redox state of the plastoquinone pool, affects plastochromanol-8 and vitamin K1 production
Sequence LengthFull length protein is 120 AA

Future Research Directions

Further research could focus on:

  • Detailed Structural Analysis: High-resolution structural studies to understand the precise mechanism of electron transfer.

  • Regulation: Investigating the regulatory mechanisms that control the expression and activity of ndhC.

  • Interaction with Other Proteins: Identifying other proteins that interact with ndhC to form the functional NAD(P)H dehydrogenase complex .

  • Role in Stress Response: Understanding the role of ndhC in plant responses to environmental stresses such as high light and drought.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Psilotum nudum (Whisk fern) (Lycopodium nudum)
Target Names
ndhC
Target Protein Sequence
MFMLPKYQTFWVFIMISSLIPLLALLISRLLAPVSKGPEKMTSYESGIEPMGDAWIQFQI RYYSFALVFVIFDVETVFLYPWAMSFYELGIFAFIEALIFVFILIIGLVYAWRKRALEWS
Uniprot No.

Target Background

Function

Function: NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.