Recombinant Psilotum nudum NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

What is the evolutionary significance of ndhE in Psilotum nudum?

The ndhE gene in Psilotum nudum represents an important evolutionary marker in plant adaptation from aquatic to terrestrial environments. As a "living fossil," P. nudum retains primitive characteristics that make it valuable for studying plant evolution. The ndh genes, including ndhE, are conserved in the plastid DNA of bryophytes, ferns, and photosynthetic higher plants, but have been lost in most algae lineages, suggesting they provide advantages specifically for terrestrial adaptation . Methodologically, researchers investigating the evolutionary significance should employ comparative genomics approaches across multiple species, focusing on the conservation patterns of ndh genes throughout different plant lineages.

What is the amino acid sequence and structural characteristics of P. nudum ndhE protein?

The P. nudum ndhE protein consists of 106 amino acids with the following sequence: MKFANIFALEHLLTLGAYLFCIGFYGLITSQNMIKALMCLELVLNAVNINFVTFSNYFDT QHIKGEIFVLFIMAIAAAEAAIGLAIVLTIYRDRKSIRIDQFNLLK . This protein functions as part of the NAD(P)H-quinone oxidoreductase complex (also known as NADH dehydrogenase or Complex I). Methodologically, researchers should approach structural studies through protein crystallography, molecular modeling, and sequence analysis techniques that compare the ndhE protein with homologous structures in other organisms. Particular attention should be paid to conserved domains that might indicate functional significance.

What methodologies are most effective for isolating and purifying recombinant P. nudum ndhE protein for functional studies?

For optimal isolation and purification of recombinant P. nudum ndhE protein, researchers should employ a multi-step approach. First, the ndhE gene should be PCR-amplified from chloroplast DNA extracted using the differential centrifugation method (1000g for initial separation, followed by 3000g for chloroplast fraction) . The gene should then be cloned into an appropriate expression vector with a tag for purification. Expression in E. coli BL21(DE3) or a similar strain is recommended, followed by purification via affinity chromatography.

For functional studies, it's crucial to maintain the protein in a Tris-based buffer with 50% glycerol as used for commercial preparations . Researchers should verify protein purity via SDS-PAGE and Western blot, and confirm activity through enzymatic assays measuring NAD(P)H oxidation rates. The isolated protein should be stored at -20°C for short-term use or -80°C for extended storage, avoiding repeated freeze-thaw cycles .

How do cell wall characteristics in P. nudum tissues affect protocols for extraction and analysis of chloroplast proteins like ndhE?

The unique cell wall composition of P. nudum creates specific challenges for protein extraction protocols. Unlike typical higher plants, P. nudum has mannan-based primary cell walls with xyloglucan and methylesterified homogalacturonans . Its cortical fibers have secondary cell walls enriched in mannan, while tracheids contain xylan and lignin as major polymers . This distinctive composition necessitates modified extraction protocols.

For effective chloroplast protein extraction from P. nudum:

• Use tissue maceration with 3% Macerozyme in PBS (pH 6.0) at 30°C to break down the mannan-rich cell walls

• Employ homogenization in a buffer containing Tris-HCl (pH 8.0), EDTA, sucrose, 2-mercaptoethanol, and BSA

• Implement differential centrifugation (1000g for 10s followed by 3000g for 10min) to isolate chloroplast-rich fractions

• Extract proteins with phenol/chloroform/isoamyl alcohol (25:24:1) after solubilization in extraction buffer

These steps account for the unique structural characteristics of P. nudum tissues and optimize protein yield for downstream analysis.

What are the current hypotheses explaining the retention of ndh genes in P. nudum despite their loss in various other plant lineages?

Several hypotheses attempt to explain why P. nudum has retained ndh genes while they have been lost in other plants. The primary hypothesis suggests that the Ndh complex provides adaptive advantages in specific environmental conditions by protecting photosynthetic efficiency under terrestrial stresses . The retention may reflect P. nudum's particular ecological niche and evolutionary history as a "living fossil."

Methodologically, researchers should investigate this question through:

• Comparative transcriptomics under various stress conditions (drought, high light, temperature fluctuations)

• Functional complementation studies in ndh-deficient mutants

• Measurements of photosynthetic efficiency and cyclic electron flow in P. nudum compared to plants lacking ndh genes

Research findings indicate that ndh genes protect angiosperms under terrestrial stresses, maintaining efficient photosynthesis . The extremely low abundance of Ndh protein (approximately 0.2% of thylakoid protein) suggests its importance may lie in specialized functions rather than bulk photosynthetic activity.

What RNA editing patterns are observed in P. nudum ndhE transcripts and how should they be analyzed?

RNA editing is a critical post-transcriptional modification in chloroplast genes, and researchers investigating ndhE in P. nudum should be aware that significant editing likely occurs. Based on findings from other bryophytes like Anthoceros formosae, where more than half of chloroplast protein-coding genes have nonsense codons converted to sense codons by RNA editing , researchers should expect similar patterns in P. nudum ndhE transcripts.

The recommended methodology for RNA editing analysis includes:

• Total RNA isolation using CTAB with modifications as described for Anthoceros

• cDNA synthesis using specific primers designed for the ndhE region

• Parallel sequencing of genomic DNA and cDNA for the same region

• Comparative analysis to identify C-to-U and U-to-C editing sites

• Prediction of the effects of editing on protein structure and function

This approach will reveal the extent and significance of RNA editing in P. nudum ndhE and contribute to understanding its evolutionary and functional implications.

How should researchers interpret contradictory data regarding the function of ndhE in cyclic electron flow versus stress responses?

When faced with contradictory data regarding ndhE function, researchers should implement a systematic analytical approach:

• Distinguish between direct and indirect measurements of ndhE function

• Evaluate experimental conditions for each study, particularly light intensity, CO2 levels, and stress conditions

• Consider species-specific differences, as ndh gene function may vary between early land plants like P. nudum and angiosperms

• Analyze the temporal dynamics of responses, as ndhE may function differently under short-term versus long-term stress

Research suggests that ndh genes are conserved in land plants but can be lost in some photosynthetic species , indicating their function may be context-dependent. The approximate 0.2% abundance of Ndh proteins in thylakoid membranes suggests they may function in specialized conditions rather than in primary photosynthetic processes.

For resolving contradictions, researchers should design experiments that:

• Measure cyclic electron flow directly using spectroscopic methods

• Compare photosynthetic efficiency under various stresses in wild-type versus ndhE-suppressed plants

• Analyze protein-protein interactions of ndhE to identify partners in different functional contexts

What are the recommended protocols for studying the integration of ndhE into the thylakoid membrane and its assembly into the Ndh complex?

To study the integration of ndhE into thylakoid membranes and its assembly into the Ndh complex, researchers should employ a multi-faceted approach:

• Membrane Protein Isolation:

  • Isolate chloroplasts from P. nudum using differential centrifugation

  • Fractionate thylakoid membranes using sucrose gradient centrifugation

  • Extract membrane proteins with mild detergents (0.5-1% β-DDM or digitonin)

• Protein Complex Analysis:

  • Perform blue native PAGE to separate intact complexes

  • Use second-dimension SDS-PAGE to identify individual components

  • Confirm complex composition via mass spectrometry

• Protein Interaction Studies:

  • Conduct co-immunoprecipitation with antibodies against ndhE

  • Perform split-ubiquitin or yeast two-hybrid assays for interaction partners

  • Use chemical crosslinking followed by MS analysis to identify neighboring proteins

• Assembly Kinetics:

  • Pulse-chase experiments with radioactively labeled amino acids

  • Time-course sampling after chloroplast isolation and protein synthesis

These methodologies will provide insights into how the ndhE protein, which has the amino acid sequence specified in search result , is incorporated into functional complexes within the unique cell wall architecture of P. nudum .

How can researchers effectively compare the ndhE gene function between P. nudum and plants that have lost this gene during evolution?

To effectively compare ndhE function between P. nudum and plants lacking this gene, researchers should implement a comprehensive comparative framework:

• Phylogenetic Context Establishment:

  • Construct robust phylogenies of plant lineages showing ndh gene retention/loss

  • Identify multiple independent loss events for stronger comparative power

  • Include close relatives of P. nudum with and without ndhE when possible

• Functional Compensation Analysis:

  • Examine alternative electron transport pathways in species lacking ndhE

  • Measure cyclic electron flow capacity across species using spectroscopic methods

  • Investigate expression levels of potential compensatory genes in ndh-deficient plants

• Photosynthetic Efficiency Comparison:

  • Design standardized stress protocols (drought, high light, temperature)

  • Measure chlorophyll fluorescence parameters (Fv/Fm, NPQ, ETR) across species

  • Quantify growth rates and fitness metrics under controlled conditions

Research has shown that independent losses of ndh genes have occurred in multiple plant lineages, including families in the order Alismatales, Tofieldiaceae, aquatic species like Najas flexilis, and specific varieties like Capparis spinosa var. herbacea . This pattern suggests that functional compensation mechanisms exist and should be identified.

What experimental design would best determine if the mannan-rich cell wall composition of P. nudum interacts with chloroplast function, particularly regarding the ndh complex?

The unique mannan-rich cell wall composition of P. nudum may impact chloroplast function and the ndh complex. To investigate potential interactions, researchers should implement the following experimental design:

• Comparative Cell Wall-Chloroplast Analysis:

  Plant Species	Cell Wall Composition	ndh Complex Structure	Photosynthetic Parameters
  P. nudum	Mannan-rich	To be determined	To be measured
  Other ferns	Various	To be determined	To be measured
  Angiosperms	Cellulose-rich	To be determined	To be measured

• Cell Wall Modification Experiments:

  • Treat P. nudum tissues with specific cell wall-degrading enzymes (mannases)

  • Measure resulting changes in chloroplast morphology and function

  • Analyze ndh complex stability and function before and after treatments

• Developmental Studies:

  • Track coordinated expression of cell wall biosynthesis genes and ndh genes

  • Analyze spatial relationships between developing cell walls and chloroplasts

  • Identify potential signaling pathways connecting cell wall status to chloroplast function

Research has shown that P. nudum has primary cell walls based on mannan with epitopes for xyloglucan and methylesterified homogalacturonans , creating a unique cellular environment that may influence organelle function differently than in plants with typical cellulose-based cell walls.

What novel questions about ndhE in P. nudum remain unexplored that could advance our understanding of chloroplast evolution?

Several promising research directions regarding ndhE in P. nudum remain unexplored:

• Post-translational Modification Landscape:

  • Identify phosphorylation, acetylation, and other modifications of ndhE

  • Compare PTM patterns between P. nudum and other plants

  • Determine functional consequences of these modifications

• Lateral Gene Transfer Possibilities:

  • Investigate whether horizontal gene transfer has influenced ndhE evolution

  • Compare nuclear and chloroplast copies of ndh genes

  • Analyze codon usage patterns for evidence of gene transfer

• Epigenetic Regulation:

  • Examine methylation patterns in the ndhE gene region

  • Analyze chromatin structure around the gene in nucleoids

  • Investigate potential small RNA regulation of ndhE expression

• Stress Response Network Integration:

  • Map the position of ndhE in global stress response networks

  • Identify transcription factors controlling ndhE expression

  • Determine how ndhE function integrates with other stress response mechanisms

These research directions would benefit from the integration of modern techniques including CRISPR-Cas9 editing, single-cell omics, and advanced imaging methods applied to this evolutionarily significant "living fossil."

What methodological advances would improve the study of protein-protein interactions involving ndhE in the thylakoid membrane?

To advance studies of protein-protein interactions involving ndhE in thylakoid membranes, researchers should consider these methodological improvements:

• Advanced Microscopy Techniques:

  • Implement super-resolution microscopy (PALM/STORM) to visualize ndhE localization

  • Use FRET-FLIM to detect direct protein interactions in intact chloroplasts

  • Develop correlative light-electron microscopy protocols for P. nudum chloroplasts

• Membrane Protein Complex Stabilization:

  • Optimize mild detergents specifically for P. nudum thylakoid membranes

  • Develop nanodiscs or amphipol systems for ndh complex stabilization

  • Implement on-membrane cross-linking before extraction

• Mass Spectrometry Innovations:

  • Apply hydrogen-deuterium exchange MS to map interaction surfaces

  • Implement proximity labeling (BioID, APEX) followed by MS analysis

  • Develop targeted proteomics methods for low-abundance ndh components

• In vivo Tracking Systems:

  • Develop split-GFP or related systems optimized for chloroplast use

  • Implement optogenetic tools to control protein interactions

  • Adapt FRAP techniques for studying dynamics of membrane protein complexes

These methodological advances would address the challenges posed by the extremely low abundance of Ndh proteins (approximately 0.2% of thylakoid protein) and the unique cellular architecture of P. nudum with its distinctive cell wall composition .