Recombinant Psilotum nudum NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

What is Psilotum nudum NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)?

NAD(P)H-quinone oxidoreductase subunit 6 (ndhG) is a plastid-encoded protein component of the chloroplast NADH dehydrogenase-like complex (NDH). This protein is classified as EC 1.6.5.- and is also known by alternative names including NAD(P)H dehydrogenase subunit 6 and NADH-plastoquinone oxidoreductase subunit 6. In Psilotum nudum, a primitive vascular plant often described as a "living fossil," ndhG is particularly significant for studying the evolution of photosynthetic mechanisms .

The protein consists of 188 amino acids with the sequence: MNLPESIQKGILLIIELGILLGSMGVILLNDIVQSAFSLGLTFISISLLYLVLNADFVAAAQVLIYVGAINVLIVFSVMLIQKPHKNEDLSTSRNTGNNITLIVCTSLFLFLFVSIILDTSWSQIYSIKKSTKIFEPILKSNVQLIGSQLLTEFLLPFELLSVLLLVALVGAITMSRQSRMFEMPDDEI . The ndhG subunit is part of the membrane subcomplex within the larger NDH complex structure .

How does ndhG function within the chloroplast NDH complex?

The ndhG protein functions as an integral component of the membrane subcomplex of the chloroplast NDH. This complex mediates photosystem I cyclic electron transport and chlororespiration in thylakoid membranes . Recent research indicates that chloroplast NDH accepts electrons from ferredoxin (Fd) rather than directly from NAD(P)H, with specific subunits forming the Fd binding site .

The NDH complex can be divided into four distinct subcomplexes: membrane, lumen, and stroma-exposed A and B subcomplexes. The membrane subcomplex, which includes ndhG along with other plastid-encoded subunits (NdhA-NdhG), forms the core transmembrane structure necessary for proton translocation and electron transport activities . Through its association with Photosystem I (PSI), forming the NDH-PSI supercomplex, the complex contributes to cyclic electron flow, particularly important under high light conditions .

What is the evolutionary significance of studying ndhG in Psilotum nudum?

Psilotum nudum represents a unique model organism for evolutionary studies of photosynthetic mechanisms. While morphologically resembling leafless Devonian early vascular plants, molecular studies have shown that P. nudum is actually closely related to Equisetum and more advanced than Selaginella, Isoetes, and Lycopodium . This makes it an excellent subject for studying the evolution of photosynthetic complexes.

The study of ndhG in P. nudum provides insight into the evolutionary trajectory of the NDH complex across land plant lineages. Comparative analysis of the ndhG sequence and structure across different plant species can reveal patterns of conservation and divergence, illuminating the evolutionary pressures that have shaped photosynthetic electron transport systems .

P. nudum's position as a "living fossil" with unique cell wall characteristics (notably mannan-based secondary cell walls in its cortical fibers, unlike the xylan and lignin composition in its tracheids) makes it an important reference point for understanding the evolution of plant structural and functional biology .

What methodologies are optimal for expressing and purifying recombinant P. nudum ndhG?

When expressing and purifying recombinant P. nudum ndhG, researchers should consider the following protocol based on current best practices:

Expression System Selection:

• Bacterial expression (E. coli) may be suitable for basic structural studies but could lack post-translational modifications

• Plant-based expression systems (N. benthamiana transient expression) might better preserve native structure

• Insect cell expression systems can be employed for membrane proteins requiring eukaryotic folding machinery

Purification Strategy:

• Harvest and homogenize expression system tissue

• Isolate membrane fractions through differential centrifugation

• Solubilize membranes using mild detergents (e.g., n-dodecyl β-D-maltoside)

• Utilize affinity chromatography with appropriate tags (His-tag is common)

• Apply size-exclusion chromatography for final purification

• Store in Tris-based buffer with 50% glycerol at -20°C or -80°C

For optimal results, researchers should note that repeated freezing and thawing is not recommended. Working aliquots should be stored at 4°C for up to one week . The tag type is typically determined during the production process to optimize expression and functionality .

How does the assembly of the NDH complex occur and what role does ndhG play?

The assembly of the chloroplast NDH complex occurs through a multistep process involving both nuclear and plastid-encoded components. This process requires coordinated interplay between products from both genomes and likely proceeds in a stepwise manner similar to the assembly of other photosynthetic complexes .

NDH Complex Assembly Pathway:

• The NDH complex is divided into four subcomplexes:

  • Membrane subcomplex (containing NdhA-NdhG)

  • Lumen subcomplex

  • Stroma-exposed subcomplex A (containing NdhH-NdhK and NdhL-NdhO)

  • Stroma-exposed subcomplex B

• Assembly intermediates of varying molecular masses (approximately 800, 500, and 400 kD) have been identified in the chloroplast stroma, suggesting that subcomplex assembly occurs there .

• The ndhG protein, as part of the membrane subcomplex, is incorporated into the complex during the integration of plastid-encoded components .

• Multiple assembly factors have been identified as necessary for NDH complex assembly, including CHLORORESPIRATORY REDUCTION (CRR) proteins such as CRR1, CRR6, CRR7, CRR41, and CRR42 .

• The assembly process involves iron-sulfur cluster formation in certain subunits, with factors like HCF101 potentially required for the formation of [4Fe-4S] clusters in NDH subunits .

The proper folding and incorporation of NDH subunits is critical, as evidenced by studies showing that only properly folded NdhH can be incorporated into specific assembly intermediates .

What techniques are most effective for studying ndhG interactions within the NDH complex?

To study ndhG interactions within the NDH complex, researchers can employ multiple complementary techniques:

In vivo Approaches:

• Split-protein Complementation Assays: Using split fluorescent proteins or luciferase to detect protein-protein interactions

• FRET/BRET Analysis: For studying proximity and dynamics of interactions in living cells

• Co-immunoprecipitation: To isolate interacting proteins from plant tissue extracts

• Crosslinking Mass Spectrometry: To identify interaction interfaces between subunits

In vitro Methods:

• Blue Native PAGE: For separating intact protein complexes and identifying subcomplexes

• Surface Plasmon Resonance: To quantify binding kinetics between purified components

• Isothermal Titration Calorimetry: For thermodynamic characterization of interactions

• Hydrogen-Deuterium Exchange Mass Spectrometry: To identify regions involved in subunit interactions

Genetic Approaches:

• Site-directed Mutagenesis: To identify critical residues for interactions

• Suppressor Screens: To identify genetic interactions

• CRISPR/Cas9 Editing: For precise manipulation of ndhG and assessment of assembly consequences

Research on other NDH subunits has employed interactive proteomic analyses to identify assembly factors and subcomplex components . Similar approaches could be applied to ndhG to elucidate its specific interactions and assembly requirements.

How does environmental stress affect ndhG expression and NDH complex function?

The NDH complex plays a crucial role in cyclic electron flow around Photosystem I, a process particularly important under environmental stress conditions. While the provided search results don't directly address ndhG expression under stress, we can outline methodological approaches to studying this question:

Methodological Approach to Studying Stress Responses:

• Transcript Analysis:

  • RT-qPCR to quantify ndhG transcript levels under various stresses

  • RNA-seq for genome-wide expression changes in coordination with ndhG

  • Nascent RNA analysis to determine transcriptional vs. post-transcriptional regulation

• Protein Analysis:

  • Western blotting with specific antibodies to track ndhG protein levels

  • Pulse-chase experiments to determine protein turnover rates under stress

  • Blue native PAGE to assess NDH complex assembly and stability

• Functional Analysis:

  • Chlorophyll fluorescence measurements to assess NDH activity

  • P700 redox kinetics to quantify cyclic electron flow

  • Electrochromic shift measurements to assess proton motive force generation

• Physiological Relevance:

  • Growth and photosynthetic performance of ndhG mutants vs. wild-type under stress

  • Reactive oxygen species production and antioxidant system activation

  • Energy balance and ATP/NADPH ratio determination

Research has shown that the NDH-PSI supercomplex is required for stabilization of NDH, especially under strong light conditions , suggesting that environmental factors directly influence NDH complex stability and potentially ndhG expression or post-translational modifications.

What structural features distinguish ndhG from other NDH complex subunits?

The structural features of ndhG can be analyzed at multiple levels:

Primary Structure:
The 188-amino acid sequence of P. nudum ndhG (MNLPESIQKGILLIIELGILLGSMGVILLNDIVQSAFSLGLTFISISLLYLVLNADFVAAAQVLIYVGAINVLIVFSVMLIQKPHKNEDLSTSRNTGNNITLIVCTSLFLFLFVSIILDTSWSQIYSIKKSTKIFEPILKSNVQLIGSQLLTEFLLPFELLSVLLLVALVGAITMSRQSRMFEMPDDEI) contains multiple hydrophobic regions consistent with its role as a membrane protein .

Secondary and Tertiary Structure:
While the crystal structure of P. nudum ndhG has not been directly reported in the provided search results, structural insights can be derived from homologous proteins. The bacterial homolog in Thermus thermophilus (respiratory complex I) has been crystallized, revealing important structural features that may be shared with the chloroplast NDH complex .

Functional Domains:
Based on homology to bacterial complex I and the functional studies of NDH, we can infer that ndhG contains:

• Transmembrane helices for membrane anchoring

• Interfaces for interaction with other membrane subcomplex components

• Structural elements that contribute to the proton translocation pathway

Comparative Analysis:
Unlike some other NDH subunits such as NdhI and NdhK, which bind iron-sulfur clusters , ndhG likely does not contain metal binding sites. It functions primarily as a structural component of the membrane subcomplex rather than directly participating in electron transfer.

What are the challenges in reconstituting functional ndhG in vitro?

Reconstituting functional membrane proteins like ndhG presents several methodological challenges:

Key Challenges and Methodological Solutions:

• Membrane Protein Solubility:

  • Challenge: Hydrophobic nature leads to aggregation

  • Approach: Screen multiple detergents (mild non-ionic detergents often preferred)

  • Method: Systematic detergent screening using thermal stability assays

• Maintaining Native Conformation:

  • Challenge: Detergents may distort protein structure

  • Approach: Use of nanodiscs, amphipols, or lipid cubic phase

  • Method: Circular dichroism to monitor secondary structure integrity

• Assembly into Functional Complex:

  • Challenge: NDH complex contains multiple subunits requiring orchestrated assembly

  • Approach: Co-expression of multiple subunits or step-wise reconstitution

  • Method: Activity assays to verify function of reconstituted complexes

• Stability Issues:

  • Challenge: The NDH complex is known to be fragile

  • Approach: Optimization of buffer conditions (50% glycerol has been used for storage)

  • Method: Stability assays under various conditions

• Functional Assessment:

  • Challenge: Verifying activity of reconstituted protein

  • Approach: Development of in vitro electron transport assays

  • Method: Spectroscopic techniques to monitor electron transfer

The low abundance and fragile nature of chloroplast NDH makes biochemical approaches challenging , necessitating creative experimental designs that combine genetic, biochemical, and biophysical approaches.

What controls should be included when studying recombinant ndhG function?

When designing experiments to study recombinant ndhG function, the following controls should be considered:

Positive Controls:

• Native NDH complex isolated from P. nudum chloroplasts

• Reconstituted complex with known functional activity

• Recombinant bacterial homologs with established activity assays

Negative Controls:

• Denatured ndhG protein

• Site-directed mutants with predicted loss of function

• Omission of essential cofactors in activity assays

• NDH complexes lacking ndhG

Sample Processing Controls:

• Parallel processing of samples to minimize batch effects

• Time-course controls for stability assessment

• Storage condition comparisons (working aliquots at 4°C vs. frozen stocks)

Technical Validation:

• Multiple methods to verify protein identity (mass spectrometry, Western blotting)

• Structural integrity verification (circular dichroism, thermal shift assays)

• Purity assessment (SDS-PAGE, size exclusion chromatography)

These controls help distinguish specific ndhG-related effects from artifacts and establish the reliability and reproducibility of experimental findings.

How can researchers troubleshoot issues with ndhG expression and purification?

When encountering difficulties with ndhG expression and purification, researchers can implement the following systematic troubleshooting approach:

Expression Troubleshooting:

Purification Troubleshooting:

Storage recommendations include keeping the protein in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage, while avoiding repeated freeze-thaw cycles .

What analytical techniques can determine if recombinant ndhG is properly folded?

Determining proper folding of recombinant ndhG requires multiple complementary analytical techniques:

Spectroscopic Methods:

• Circular Dichroism (CD): Provides information about secondary structure content (α-helices, β-sheets)

• Fluorescence Spectroscopy: Intrinsic tryptophan fluorescence can indicate tertiary structure integrity

• Fourier-Transform Infrared Spectroscopy (FTIR): Offers detailed secondary structure information especially useful for membrane proteins

Hydrodynamic Techniques:

• Size Exclusion Chromatography: Assesses aggregation state and homogeneity

• Dynamic Light Scattering: Measures size distribution and detects aggregation

• Analytical Ultracentrifugation: Provides detailed information on size, shape, and homogeneity

Stability Assays:

• Thermal Shift Assays: Monitor protein unfolding as temperature increases

• Chemical Denaturation: Assess stability against chemical denaturants

• Limited Proteolysis: Properly folded proteins often show distinctive proteolysis patterns

Functional Assessment:

• Binding Assays: Test interaction with known binding partners

• Activity Assays: Measure enzymatic activity or complex formation

• Native PAGE: Compare migration pattern with native complex

The storage conditions and recommendations mentioned in the search results (storage at -20°C in Tris-based buffer with 50% glycerol) suggest stability concerns that should be addressed through these analytical techniques.

How does P. nudum ndhG compare with homologs in other plant species?

Comparative analysis of P. nudum ndhG with homologs in other plant species can provide insights into evolutionary conservation and functional significance:

Methodological Approach for Comparative Analysis:

• Sequence Analysis:

  • Multiple sequence alignment of ndhG across diverse plant lineages

  • Calculation of sequence identity and similarity percentages

  • Identification of conserved motifs and variable regions

  • Analysis of selection pressure using dN/dS ratios

• Structural Comparison:

  • Homology modeling based on bacterial complex I structures

  • Identification of conserved structural features

  • Analysis of species-specific variations in potential functional regions

• Phylogenetic Analysis:

  • Construction of phylogenetic trees to trace evolutionary history

  • Correlation with known evolutionary relationships among plant groups

  • Identification of potential horizontal gene transfer events

• Functional Conservation:

  • Comparison of biochemical properties

  • Cross-species complementation studies

  • Analysis of expression patterns across species

P. nudum occupies an interesting evolutionary position, appearing morphologically similar to Devonian early vascular plants while molecularly related to Equisetum and more advanced than some other early plant lineages . This makes its ndhG particularly valuable for understanding the evolution of photosynthetic electron transport.

What insights can structural modeling provide about ndhG function?

Structural modeling of ndhG can provide valuable insights into its function within the NDH complex:

Structural Modeling Approach:

Based on homology to bacterial respiratory complex I, structural modeling can help identify critical residues for membrane integration, subunit interactions, and potentially proton translocation, even in the absence of direct structural data for P. nudum ndhG.

What emerging technologies could advance our understanding of ndhG and the NDH complex?

Several emerging technologies hold promise for advancing our understanding of ndhG and the NDH complex:

Structural Biology Advances:

• Cryo-Electron Microscopy: Enabling structure determination of membrane protein complexes without crystallization

• Single-Particle Analysis: For capturing conformational heterogeneity and dynamic states

• Cross-linking Mass Spectrometry: Providing spatial constraints for modeling complex assembly

• Integrative Modeling: Combining data from multiple experimental techniques

Functional Analysis Innovations:

• Time-Resolved Spectroscopy: For capturing electron transfer events in real-time

• Single-Molecule Techniques: To observe individual complex behavior and heterogeneity

• In-cell NMR: For studying protein structure and dynamics in native-like environments

• Native Mass Spectrometry: For analyzing intact complexes and their composition

Genetic and Molecular Approaches:

• CRISPR/Cas Systems: For precise genome editing to study ndhG function

• Optogenetics: To control NDH complex activity with light

• Proximity Labeling: For in vivo identification of interaction partners

• Synthetic Biology: To create minimal systems for studying essential functions

Computational Methods:

• Machine Learning: For predicting protein-protein interactions and functional sites

• Molecular Dynamics Simulations: To study protein dynamics at atomic resolution

• Quantum Mechanics/Molecular Mechanics: For studying electron transfer mechanisms

• Systems Biology Approaches: To integrate NDH function into cellular energetics

These technologies could help address the challenges posed by the low abundance and fragile nature of the chloroplast NDH complex , enabling more detailed molecular understanding of ndhG function.

What are the critical unresolved questions about ndhG in photosynthetic electron transport?

Despite progress in understanding the NDH complex, several critical questions about ndhG remain unresolved:

Fundamental Structural Questions:

Assembly and Regulation:

• What is the step-by-step assembly pathway for incorporating ndhG into the NDH complex?

• What chaperones and assembly factors specifically facilitate ndhG integration?

• How is ndhG expression regulated in response to environmental conditions?

Evolutionary Aspects:

• How has ndhG evolved across different plant lineages, particularly in P. nudum as a "living fossil"?

• What selective pressures have shaped ndhG sequence and function?

• How does ndhG in P. nudum compare to homologs in other early land plants?

Functional Mechanisms:

• What is the precise role of ndhG in proton translocation?

• How does it contribute to the efficiency of cyclic electron flow?

• What post-translational modifications affect ndhG function?

Addressing these questions requires integrating structural biology, biochemistry, genetics, and evolutionary analysis approaches. The unique position of P. nudum in plant evolution makes its ndhG particularly valuable for understanding the evolution of photosynthetic electron transport mechanisms .

How can researchers optimize storage conditions for recombinant ndhG protein?

Based on the provided information and standard practices for membrane proteins, researchers can optimize storage conditions for recombinant ndhG using the following approaches:

Recommended Storage Protocol:

• Buffer Composition:

  • Tris-based buffer with 50% glycerol has been reported as effective

  • pH should be maintained between 7.0-8.0 to ensure protein stability

  • Consider adding reducing agents (DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues

• Temperature Considerations:

  • Store at -20°C for routine use or -80°C for extended storage

  • Avoid repeated freeze-thaw cycles as they can lead to protein denaturation

  • Working aliquots can be stored at 4°C for up to one week

• Additive Screening:

  • Screen various stabilizing agents (sucrose, trehalose, specific lipids)

  • Test detergent types and concentrations for optimal stability

  • Consider adding specific metal ions if they enhance stability

• Stability Assessment:

  • Regular monitoring of protein integrity through gel electrophoresis

  • Functional assays to verify activity retention

  • Thermal shift assays to quantify stability under different conditions

This systematic approach to optimization can help maintain ndhG stability and activity for extended periods, facilitating consistent experimental results.

What experimental design would best elucidate ndhG's role in the NDH complex?

To comprehensively elucidate ndhG's role in the NDH complex, a multifaceted experimental design is required:

Proposed Experimental Framework:

• Structure-Function Analysis:

  • Site-directed mutagenesis of conserved residues

  • Analysis of mutant impact on complex assembly and function

  • Cross-linking studies to map interaction interfaces

  • Cryo-EM analysis of intact complex with and without ndhG

• In vivo Functional Studies:

  • Generation of ndhG knockout or knockdown plants

  • Complementation with wild-type and mutant versions

  • Phenotypic analysis under various environmental conditions

  • Measurement of photosynthetic parameters (chlorophyll fluorescence, P700 redox kinetics)

• Assembly Pathway Characterization:

  • Pulse-chase labeling to track ndhG incorporation into complex

  • Isolation and characterization of assembly intermediates

  • Identification of ndhG-specific assembly factors

  • Time-resolved analysis of complex formation

• Comparative Analysis:

  • Study of ndhG function across evolutionary diverse species

  • Analysis of natural variants and their functional consequences

  • Correlation of sequence variations with functional differences