Recombinant Psilotum nudum Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. To prioritize a specific tag, please inform us during your order.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Psilotum nudum (Whisk fern) (Lycopodium nudum)
Target Names
ycf4
Target Protein Sequence
MKRQSEWIRVESIRGARRISNFFWAFILILGALGFLLVGSSSYLGRDLIPLLPSQQIVFI PQGIVMCFYGIAGISIGFYLGFAISWDIGNGYNLFDKQRGIVRIFRWGFPGENRRICIQF FMKDIQAIGLEIREGFYSRRIIYMRMKGQQKIFLTHISENSTLKEMEEKAANLARFMCVS IEGI
Uniprot No.

Target Background

Function

Appears essential for the assembly of the photosystem I complex.

Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and sequence of Psilotum nudum Ycf4 protein?

Psilotum nudum Ycf4 is a 184-amino acid protein with the UniProt accession number Q8WI09. The complete amino acid sequence is: "MKRQSEWIRVESIRGARRISNFFWAFILILGALGFLLVGSSSYLGRDLIPLLPSQQIVFIPQGIVMCFYGIAGISIGFYLGFAISWDIGNGYNLFDKQRGIVRIFRWGFPGENRRICIQFFMKDIQAIGLEIREGFYSRRIIYMRMKGQQKIFLTHISENSTLKEMEEKAANLARFMCVSIEGI" . This protein maintains the typical length of most Ycf4 proteins (184-185 amino acids), unlike some legume species where the protein has expanded to approximately 200 residues . The protein is expressed from region 1-184 of the gene and functions as a thylakoid protein involved in photosystem I assembly . Research indicates it is a membrane-associated protein, consistent with its role in the thylakoid membrane where photosystem assembly occurs.

What is the functional role of Ycf4 in photosystem I assembly?

Experimental evidence, primarily from studies in Chlamydomonas, indicates that Ycf4 serves as the second of three scaffold proteins that act sequentially during photosystem I assembly . The protein performs two critical functions in this process: first, it stabilizes an intermediate subcomplex consisting of the PsaAB heterodimer and the three stromal subunits PsaCDE; second, it facilitates the addition of the PsaF subunit to this subcomplex . This scaffolding function is essential, as demonstrated in Chlamydomonas where Ycf4 has been shown to be absolutely required for photosystem I assembly, while in cyanobacteria it plays a regulatory role in the assembly process . Understanding these functional aspects is crucial for researchers studying photosynthetic machinery, as proper assembly of photosystem I is vital for efficient light harvesting and energy conversion in photosynthetic organisms.

How does P. nudum's status as a "living fossil" influence Ycf4 research significance?

Psilotum nudum represents an early diverging vascular plant lineage, often described as a "living fossil" due to its retention of primitive characteristics . This evolutionary position makes P. nudum Ycf4 particularly valuable for comparative studies investigating the evolution of photosynthetic machinery. The conserved nature of Ycf4 in P. nudum contrasts with the variable patterns seen in other lineages like legumes, potentially offering insights into the ancestral function and structure of this protein . Research on P. nudum Ycf4 can help establish evolutionary baselines for photosystem I assembly mechanisms across plant lineages. Additionally, P. nudum's distinctive cellular architecture, including its mannan-based cell walls, provides context for understanding how Ycf4 functions within different cellular environments compared to more derived plant groups .

What are effective protein expression and purification methods for recombinant P. nudum Ycf4?

Effective expression and purification of recombinant P. nudum Ycf4 typically requires specialized approaches due to its membrane protein characteristics. Researchers should consider the following methodology:

  • Expression system selection: Bacterial systems (E. coli) can be used but may require optimization for membrane proteins. Alternatively, eukaryotic systems like yeast or insect cells may better accommodate proper folding.

  • Optimization protocol: Include membrane-mimicking detergents during purification to maintain protein stability and native conformation. Common detergents include n-dodecyl β-D-maltoside (DDM) or digitonin.

  • Tag selection: While the specific tag will be determined during the production process, histidine tags are commonly used for membrane proteins . Consider testing multiple tag positions (N-terminal versus C-terminal) to identify optimal expression.

  • Buffer composition: For storage, recombinant P. nudum Ycf4 protein stability is maintained in Tris-based buffer with 50% glycerol at -20°C for standard storage, or -80°C for extended storage . Repeated freeze-thaw cycles should be avoided, with working aliquots stored at 4°C for up to one week.

  • Quality control: Verify recombinant protein integrity through SDS-PAGE, Western blotting, and functional assays to ensure the protein maintains native conformation and activity.

How can researchers investigate Ycf4 interactions with other photosystem I components?

Investigating Ycf4 interactions with other photosystem I components requires sophisticated biochemical and biophysical approaches:

Co-immunoprecipitation studies:

  • Use antibodies against the recombinant Ycf4 protein to pull down associated proteins from thylakoid membrane preparations.

  • Analyze co-precipitated proteins by mass spectrometry to identify interaction partners.

  • Verify specific interactions with key proteins like PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF through Western blot analysis .

Yeast two-hybrid or split-ubiquitin systems:
These approaches can be used to identify direct protein-protein interactions, especially when modified for membrane proteins like Ycf4.

Crosslinking experiments:
Chemical crosslinking followed by mass spectrometry can help determine spatial relationships between Ycf4 and other photosystem I components within the membrane.

Blue native PAGE analysis:
This technique can resolve intermediate complexes during photosystem I assembly, allowing tracking of Ycf4-dependent steps in the assembly process by comparing wild-type to Ycf4-depleted samples.

Cryo-electron microscopy:
Advanced structural biology approaches can visualize the integration of Ycf4 into assembly intermediates, providing direct evidence of its scaffolding function during PsaF addition to the PsaAB-PsaCDE subcomplex .

What methods are recommended for analyzing Ycf4 function in P. nudum photosystem assembly?

Analyzing Ycf4 function in P. nudum photosystem assembly requires specialized methodological approaches:

RNA interference or CRISPR-based knockdowns:

  • Design constructs targeting the ycf4 gene in P. nudum

  • Analyze resulting phenotypes for photosynthetic deficiencies

  • Measure photosystem I activity through P700 oxidation kinetics

  • Quantify photosystem I complex accumulation via immunoblotting

Complementation studies:
Researchers can test functionality by expressing P. nudum Ycf4 in ycf4-deficient mutants of model organisms like Chlamydomonas to determine if it can restore photosystem I assembly.

Temporal assembly analysis:
Pulse-chase experiments using radioactive labeling can track the incorporation of newly synthesized photosystem I subunits in relation to Ycf4 activity.

Comparative analysis with other species:
The function can be compared with the well-characterized Chlamydomonas system, where Ycf4 has been shown to act as the second scaffold protein in a sequential assembly process, particularly in its role of stabilizing the PsaAB-PsaCDE subcomplex and facilitating PsaF addition .

Structural studies:
Membrane protein crystallography or cryo-electron microscopy can provide insights into structural features that enable Ycf4's scaffolding functions during photosystem I assembly.

What evolutionary patterns does ycf4 exhibit across different plant lineages?

The ycf4 gene exhibits remarkable evolutionary patterns across plant lineages, making it an excellent candidate for evolutionary studies:

Substitution rate variation:
While ycf4 is generally conserved in most angiosperms, legumes show accelerated evolution at this locus. Nonsynonymous (dN) substitution rates are dramatically elevated in certain legume lineages compared to other angiosperms, with no similar acceleration seen in other chloroplast genes like rbcL or matK from the same species . This suggests locus-specific evolutionary pressures rather than genome-wide effects.

Gene loss events:
Complete loss of the ycf4 gene has occurred in some species, including Pisum sativum (garden pea), three of six Desmodium species studied, and Clitoria ternatea . These loss events suggest that Ycf4 function may be dispensable or complemented by nuclear-encoded factors in certain lineages.

Phylogenetic incongruence:
Trees constructed using ycf4 sequences from phaseoloid legumes show incongruence with trees based on other genes, indicating an unusual evolutionary history potentially driven by accelerated evolution at codon positions 1 and 2 .

How does the mutation hotspot around ycf4 in some plants affect research approaches?

The localized hypermutation phenomenon around ycf4 has significant implications for research approaches:

Mutation rate quantification:
The genomic region around ycf4 in Lathyrus represents a dramatic hotspot for point mutations, with an increased mutation rate estimated at least 20-fold higher than the rest of the genome based on synonymous site divergence . Between some closely related Lathyrus species, the increase may be even greater. This violates the common assumption that point mutation rates are approximately constant across a genome.

Methodological considerations for phylogenetic studies:
Researchers must be cautious when using ycf4 sequences for phylogenetic reconstructions, particularly in legumes, as the accelerated evolution may lead to incorrect topology inferences . Multiple gene analyses or partition modeling approaches should be employed to account for the unusual evolutionary rate of ycf4.

Impact on sequence conservation analysis:
Standard approaches for identifying functional constraints through sequence conservation may be misleading in the ycf4 region due to the hypermutation phenomenon. The unusually high protein sequence divergence between closely related Lathyrus species (divergence time <10 Myr) exceeds that between other angiosperms and cyanobacteria (separated by >1000 Myr) .

Minisatellite formation:
The ycf4 region also appears to be a hotspot for the formation and turnover of minisatellite sequences in Lathyrus . Research approaches should account for these repetitive elements when performing sequence analysis and alignment.

What does the mannan-based cell wall composition in P. nudum reveal about the cellular environment of Ycf4?

The mannan-based cell wall composition in Psilotum nudum provides important contextual information about the cellular environment in which Ycf4 functions:

Primary cell wall composition:
P. nudum has primary cell walls based predominantly on mannan, which is common in other extant early land plants . This composition differs from the cellulose-rich primary walls typical in more derived plant lineages. Immunolabeling with the LM21 antibody reveals mannan throughout cell walls of all tissues in P. nudum stems, with particularly high detection in middle cortex fibers .

Tissue-specific secondary wall variation:
Unlike most vascular plants where secondary cell walls typically share similar composition across tissues, P. nudum shows distinct tissue-specific patterns. While tracheids in P. nudum have typical xylan and lignin-rich secondary walls (detected with LM11 antibody and phloroglucinol-HCl staining), the cortical fibers have secondary walls with composition similar to their primary walls—enriched in mannan .

Evolutionary implications:
This distinctive pattern represents the first description of mannan-based secondary cell walls in sclerenchyma fibers . The finding demonstrates that in early land plants, secondary cell wall composition is not uniform across different tissues, providing context for understanding the cellular environment in which chloroplast proteins like Ycf4 function.

Cell wall epitope distribution:
Immunolabeling studies show that only a thin outer cell wall layer in tracheids is labeled by the mannan-specific LM21 antibody, whereas in fibers, this epitope is detected throughout the entire thickness of the cell wall . This differential distribution may reflect functional adaptations in different tissue types where Ycf4 operates.

What immunodetection approaches are most effective for Ycf4 protein analysis?

Effective immunodetection of Ycf4 requires careful consideration of several methodological aspects:

Antibody selection for Ycf4 detection:

  • Primary antibodies: Custom antibodies against recombinant P. nudum Ycf4 are typically required due to the relatively limited commercial availability of Ycf4-specific antibodies.

  • Epitope selection: Target conserved regions of Ycf4 to ensure specificity, avoiding the variable regions that show accelerated evolution in some lineages .

  • Cross-reactivity testing: Validate antibodies against recombinant protein standards and test for cross-reactivity with other thylakoid proteins.

Immunolocalization protocol optimization:
For tissue-level detection, researchers should consider protocols similar to those used for cell wall epitope mapping in P. nudum :

  • Fixation: Use 4% paraformaldehyde in PBS to preserve protein epitopes while maintaining cellular structure.

  • Sectioning: Prepare thin sections (5-10 μm) of fresh or fixed tissue using a microtome.

  • Blocking: Block with 5% BSA in PBS to reduce non-specific binding.

  • Primary antibody incubation: Dilute purified anti-Ycf4 antibodies appropriately (typically 1:100 to 1:500) and incubate sections overnight at 4°C.

  • Secondary antibody: Use fluorophore-conjugated secondary antibodies (Alexa Fluor series recommended) for sensitive detection.

  • Controls: Include sections without primary antibody to assess background signal .

Western blot optimization:

  • Membrane protein extraction: Use specialized buffers containing mild detergents (0.5-1% n-dodecyl β-D-maltoside) to solubilize thylakoid membrane proteins.

  • Gel system: BN-PAGE (Blue Native PAGE) for intact complexes or SDS-PAGE with 12-15% acrylamide for denatured protein analysis.

  • Transfer conditions: Optimize for membrane proteins using low SDS concentrations and extended transfer times.

How should researchers approach comparative genomic analysis of ycf4 across species?

Comparative genomic analysis of ycf4 requires specialized approaches due to its unusual evolutionary patterns:

Sequence alignment strategies:

  • Use alignment algorithms optimized for protein-coding genes with unusual evolutionary rates, such as PRANK or MACSE.

  • Implement codon-aware alignment methods to properly handle the high substitution rates observed in ycf4.

  • Manual curation of alignments may be necessary, especially in regions with high variability or length polymorphisms .

Evolutionary rate analysis:
Researchers should implement likelihood models to estimate nonsynonymous (dN) and synonymous (dS) substitution rates on each branch of a phylogenetic tree, as done in previous studies . This approach can identify lineage-specific acceleration patterns.

Comparative table of ycf4 characteristics across representative species:

SpeciesYcf4 Length (aa)dN/dS RatioNotable FeaturesReference
P. nudum184Not determinedConserved typical length
Non-legume angiosperms184-185~0.15 (tobacco/spinach)Highly conserved
Soybean, Lotus japonicus~200ElevatedExpanded protein size
Lathyrus species200-3400.36-0.81Dramatic expansion, hypermutation
Desmodium (some species)N/AVery highGene converted to pseudogene
Pisum sativumN/AN/AComplete gene loss

Hotspot region analysis:
For detailed analysis of the mutation hotspot phenomenon, researchers should sequence not only the ycf4 gene but also the surrounding regions (accD, cemA genes and intergenic spaces) . This allows proper characterization of the extent of the hypermutation region, as seen in studies comparing L. latifolius and L. cirrhosus where elevated mutation rates extended approximately 1500 bp through the accD-ycf4 spacer and most of ycf4 itself .

What are the optimal storage and handling protocols for recombinant P. nudum Ycf4 protein?

Optimal storage and handling of recombinant P. nudum Ycf4 protein requires careful attention to buffer composition, temperature conditions, and stability considerations:

Buffer composition:
The recommended storage buffer for recombinant P. nudum Ycf4 is a Tris-based buffer containing 50% glycerol, optimized specifically for this protein . The high glycerol concentration helps prevent protein aggregation and maintains stability during freeze-thaw cycles. The exact buffer composition should be adjusted based on experimental requirements, but generally should maintain physiological pH (7.0-7.5) and include stabilizing agents appropriate for membrane proteins.

Temperature conditions:
For short-term storage (up to one week), working aliquots should be maintained at 4°C . For intermediate storage, -20°C is recommended, while long-term storage requires -80°C conditions . These temperature recommendations reflect the general stability profile of recombinant proteins while minimizing freeze-thaw damage.

Aliquoting strategy:
To minimize freeze-thaw cycles, which are particularly damaging to membrane proteins like Ycf4, researchers should divide the purified protein into single-use aliquots before freezing . Each aliquot should contain only the amount needed for a single experiment or application.

Handling precautions:
When working with the protein, avoid repeated freezing and thawing as explicitly noted in the handling recommendations . If multiple experiments are planned, prepare separate working aliquots at 4°C rather than repeatedly accessing the frozen stock.

Quality control monitoring: Researchers should periodically verify protein integrity through SDS-PAGE analysis of stored samples. For functional studies, activity assays should be performed to ensure that storage conditions maintain the protein's native properties and interaction capabilities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.