Recombinant Psilotum nudum Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Psilotum nudum Photosystem II CP47 chlorophyll apoprotein (psbB) is a genetically engineered variant of the intrinsic chlorophyll-binding protein critical for PSII assembly and function . It binds 16 chlorophyll molecules and participates in light-harvesting, photoprotection, and stabilization of the PSII reaction center .

Primary Structure

  • Molecular Weight: ~55 kDa (predicted from sequence) .

Recombinant Production

  • Expression System: E. coli with N-terminal His tag .

  • Purity: >90% (SDS-PAGE verified) .

  • Storage: Lyophilized powder in Tris-based buffer with 50% glycerol at -20°C/-80°C .

ParameterValue
SpeciesPsilotum nudum (Whisk fern)
UniProt IDQ8WHZ6
TagHis (position determined during production)
Reconstitution0.1–1.0 mg/mL in deionized water
StabilityAvoid repeated freeze-thaw cycles

Role in PSII Assembly and Repair

  • CP47 forms a scaffold for PSII assembly, interacting with PsbH, Psb34, and repair factors like Psb27/28 .

  • Mutagenesis studies in cyanobacteria (e.g., R448G in Synechocystis) show impaired PSII activity under high light, highlighting conserved functional domains .

Applications in Research

  • Antibody Production: Used as an antigen for ELISA kits .

  • Spectroscopic Studies: QM/MM simulations map chlorophyll excitation energies (e.g., B3 and B1 as most red-shifted sites) .

  • Photosynthesis Modeling: Informs energy transfer mechanisms in PSII .

Comparative Analysis with Orthologs

SpeciesLactuca sativa Welwitschia mirabilis Spinacia oleracea
UniProt IDQ332V1B2Y1Y5P04160
Chlorophyll-Binding16 molecules16 molecules16 molecules
Key Mutation SitesN/AN/AR448G (functional loss)
Storage BufferTris/PBS, 6% TrehaloseTris/PBS, 6% TrehaloseTris/PBS, 6% Trehalose

Research Gaps and Future Directions

  • Localization Studies: MALDI-MS data indicate metabolite accumulation in Psilotum chlorenchyma, but CP47’s tissue-specific roles remain unexplored .

  • Evolutionary Context: Structural comparisons with fern-lineage PSII could clarify CP47’s adaptation to low-light environments .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. For precise delivery estimates, kindly consult your local distributor.
Note: All proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Psilotum nudum (Whisk fern) (Lycopodium nudum)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLIAVHLMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRIGITKSWGGWSITGDTVSDAGIWSFEGVAAAHITLSGLLFLSAIWHWVYWDL DLFRDERTGKPSLDLPKIFGIHLFLSGVLCFGFGAFHITGLFGPGIWISDPYGLTGKVQP VDPAWGAEGFDPFIPGGIASHHIAAGILGILAGLFHLSVRPPQRLYKALRMGNVETVLSS SIAAVFFAAFVVSGTMWYGSATTPIELFGPTRYQWDQGYFQQEIDRRIRASRAEGLSLSE AWSRIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAIGWLGHAAFKDKEGHELFVRRMP TFFETFPVVLVDEEGIVRADAPFRRAESKYSVEQVGVTVEFYGGELNGVGFNDPSTVKKY ARRAQLGEIFEFDRATLKSDGVFRSSPRGWFTFGHATFALIFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTERQGI
Uniprot No.

Target Background

Function
CP47 chlorophyll apoprotein (psbB) is a crucial component of the Photosystem II (PSII) core complex. It binds chlorophyll and plays a key role in catalyzing the primary light-induced photochemical processes of PSII. PSII acts as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H2O, resulting in the production of O2 and a proton gradient that is subsequently used for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant CP47 protein?

For research applications, recombinant Psilotum nudum CP47 protein should be stored at -20°C, or at -80°C for extended storage periods. The protein is typically supplied in a Tris-based buffer with 50% glycerol, which has been optimized for protein stability. It is strongly recommended to avoid repeated freezing and thawing cycles, as this may lead to protein denaturation and loss of activity. For ongoing experiments, working aliquots can be stored at 4°C for up to one week .

How can site-directed mutagenesis be effectively applied to study CP47 function?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in the CP47 protein. Based on previous research, the following methodological framework is recommended:

  • Target Selection: Focus on conserved charged residues within functionally important domains, such as the 364E-440D region which has been shown to interact with the 33 kDa extrinsic protein of photosystem II .

  • Mutation Strategy: Consider substituting arginine residues with glycine (as in the RR384385GG mutation) or other amino acids that significantly alter charge while minimizing structural disruption .

  • Expression System Selection: For cyanobacterial CP47, Synechocystis 6803 has proven to be an effective model organism for expressing mutated variants .

  • Phenotypic Analysis: Assess oxygen evolution capacity, which has been shown to be particularly sensitive to mutations at positions 384R and 385R .

Previous research has demonstrated that while mutations at 17 conserved charged residues were introduced into the domain 364E-444R of the CP47 protein, only those at positions 384R and 385R led to a modified PS II phenotype, specifically resulting in a defective oxygen-evolving complex .

What experimental approaches can be used to study the interaction between CP47 and other photosystem II components?

Several experimental approaches can be employed to investigate CP47's interactions with other photosystem II components:

  • Biochemical Co-Immunoprecipitation: This technique has successfully demonstrated the interaction between domain 364E-440D of CP47 and the 33 kDa extrinsic protein of photosystem II .

  • Cross-linking Studies: Chemical cross-linking followed by mass spectrometry can identify amino acid residues involved in protein-protein interactions.

  • Mutagenesis Combined with Functional Assays: As demonstrated in previous research, introducing mutations at key residues (e.g., positions 384R and 385R) followed by functional assessment of oxygen evolution provides insight into critical interaction domains .

  • Structural Biology Approaches: X-ray crystallography or cryo-electron microscopy of intact photosystem II complexes can reveal the spatial relationships between CP47 and other components.

  • Comparative Analysis: Comparing sequence conservation across species can identify potentially important interaction interfaces.

What are the most effective purification strategies for recombinant CP47 protein?

Purification of recombinant CP47 protein requires careful consideration of the protein's membrane-associated nature. The following methodological approach is recommended:

  • Cell Disruption: Gentle disruption methods such as French pressure cell or sonication with appropriate buffers containing glycerol to maintain protein stability.

  • Membrane Solubilization: Utilize mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin that effectively solubilize membrane proteins while preserving native structure.

  • Chromatography Steps:

    • Initial purification using affinity chromatography if the recombinant protein contains a tag

    • Ion exchange chromatography exploiting CP47's charge properties

    • Size exclusion chromatography as a final polishing step

  • Quality Control: Assess protein purity using SDS-PAGE and Western blotting with specific antibodies against CP47.

  • Functional Verification: Confirm that the purified protein retains its native conformation using circular dichroism spectroscopy or fluorescence measurements.

What metabolomic approaches can complement CP47 research in Psilotum nudum?

While CP47 research focuses on the protein itself, understanding the broader metabolic context in Psilotum nudum can provide valuable insights. The following metabolomic approaches have proven useful:

  • Combined GC-MS and HPLC-QTOF-MS Analysis: This approach has successfully distinguished metabolic fingerprints between different organs of Psilotum nudum .

  • Principal Component Analysis (PCA): PCA of metabolomic data can reveal organ-specific metabolite distributions and correlations, as demonstrated in previous studies .

  • Targeted Analysis of Key Compounds: Special attention to arylpyrones (like psilotin and psilotinin) and biflavonoids (like amentoflavone), which show organ-specific distribution patterns in Psilotum nudum .

The metabolomic profile of Psilotum nudum varies significantly across different tissues:

Metabolite ClassBelow-ground RhizomeAbove-ground RhizomeGreen SynangiumYellow SynangiumBrown Synangium
CarbohydratesHighMediumLowLowLow
ArylpyronesVery High (psilotin)High (psilotin)MediumMediumMedium
Biflavonoid GlycosidesVery LowHighMediumHighVery High
Biflavonoid AglyconesLowHigh (amentoflavone)HighVery High (amentoflavone)High

This metabolic context may provide insights into the environmental conditions and physiological states in which CP47 functions within the plant .

How do mutations in the CP47 protein affect oxygen evolution and photosystem II function?

Research has demonstrated specific structure-function relationships within the CP47 protein that impact photosystem II activity:

  • Critical Residues: Mutations at positions 384R and 385R specifically lead to modified photosystem II phenotypes, while mutations at 15 other conserved charged residues in the domain 364E-444R did not significantly alter function .

  • Oxygen Evolution Impact: The mutation RR384385GG resulted in a mutant with a defective oxygen-evolving complex, highlighting the importance of these residues for water-splitting activity .

  • Mechanism Analysis: The effects are likely due to disrupted interaction between CP47 and the 33 kDa extrinsic protein, which is essential for stabilizing the manganese cluster involved in water oxidation .

  • Experimental Approach: Researchers investigating these effects should:

    • Create precise point mutations using site-directed mutagenesis

    • Measure oxygen evolution rates using Clark-type electrodes

    • Analyze fluorescence induction to assess electron transfer efficiency

    • Examine assembly of photosystem II using BN-PAGE and immunoblotting

Understanding these structure-function relationships is crucial for elucidating the role of CP47 in photosynthetic efficiency and could inform strategies for enhancing photosynthesis in crop plants.

What are the current challenges in expressing and characterizing recombinant photosystem II proteins?

Researchers face several significant challenges when working with recombinant photosystem II proteins like CP47:

  • Maintaining Native Conformation: The membrane-integrated nature of CP47 makes it challenging to express and purify while preserving its natural structure.

  • Cofactor Assembly: Ensuring proper chlorophyll binding and cofactor integration during recombinant expression requires specialized expression systems.

  • Functional Assessment: Developing reliable assays to confirm that recombinant CP47 maintains its native functionality.

  • Protein-Protein Interactions: Recreating the complex interactions between CP47 and other photosystem II components in reconstitution experiments.

  • Post-translational Modifications: Identifying and preserving essential post-translational modifications that may be present in native CP47.

Methodological approaches to address these challenges include:

  • Using specialized membrane protein expression systems

  • Employing mild detergents throughout purification

  • Developing reconstitution protocols with other purified photosystem II components

  • Applying advanced structural biology techniques like cryo-EM to characterize protein complexes

How does Psilotum nudum CP47 compare to homologous proteins in other photosynthetic organisms?

Comparative analysis of CP47 sequences across diverse photosynthetic organisms reveals important evolutionary insights:

  • Conservation Level: The CP47 protein is highly conserved across higher plants, green algae, and cyanobacteria, reflecting its fundamental role in photosynthesis .

  • Functional Domains: The domain 364E-440D that interacts with the 33 kDa extrinsic protein shows particular conservation, indicating evolutionary pressure to maintain this interaction interface .

  • Analytical Approach: Researchers should employ:

    • Multiple sequence alignment tools to identify conserved residues

    • Phylogenetic analysis to understand evolutionary relationships

    • Structural modeling to map conserved regions onto three-dimensional structures

    • Comparative biochemical assays to assess functional conservation

  • Research Application: Studying CP47 in Psilotum nudum is particularly valuable due to this organism's position as a primitive vascular plant, providing insights into the evolution of photosynthetic machinery during land plant diversification.

What can metabolomic studies of Psilotum nudum reveal about the evolutionary context of photosynthesis?

Metabolomic studies of Psilotum nudum provide a broader context for understanding photosystem evolution:

  • Unique Metabolites: Psilotum nudum produces distinctive compounds like arylpyrones (psilotin and psilotinin) that are unique to the Psilotaceae family .

  • Tissue-Specific Distribution: The differential accumulation of metabolites across plant organs suggests specialized metabolic roles that may have evolved alongside photosynthetic adaptations .

  • Defensive Compounds: Both arylpyrones and biflavonoids show bioactivity that may contribute to plant defense, suggesting co-evolution of photosynthetic and defensive capacities .

  • Research Directions: Integrating metabolomic data with photosystem studies can:

    • Reveal how environmental adaptations shape photosynthetic machinery

    • Identify metabolites that may interact with or protect photosystem components

    • Provide insights into the evolutionary pressures that shaped early vascular plant photosynthesis

This metabolic context is particularly valuable given Psilotum's status as a "living fossil" with primitive characteristics that reflect early stages of vascular plant evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.