Recombinant Psilotum nudum Photosystem II D2 protein (psbD)

Shipped with Ice Packs
In Stock

Description

Role in Photosystem II

  • Reaction Center Assembly: The D2 protein pairs with D1 to form the PSII reaction center, facilitating water oxidation and plastoquinone reduction .

  • Electron Transfer: The stromal-exposed D-de loop of D2 maintains PSII structural integrity while allowing flexibility for electron transfer .

  • Stress Adaptation: Cyanobacterial homologs (e.g., Synechococcus psbD) show dynamic regulation under light stress, with isoform switching (D1:1 to D1:2) enhancing photodamage repair .

Biogenesis and Stability

  • Assembly Factors: Proteins like Ycf48 and Psb28 assist in D1/D2 heterodimer formation and CP47 integration during PSII assembly .

  • Post-Translational Modifications: The C-terminal extension of precursor D1 (pD1) is processed by CtpA peptidase, a step critical for functional PSII .

Experimental Use Cases

  • Photosynthesis Mechanisms: Used to study PSII electron transport kinetics and photoinhibition resistance .

  • Mutagenesis Studies: Chimeric D2 proteins with altered loops reveal functional tolerance to structural changes, aiding PSII engineering .

  • Immunological Assays: Detects PSII deficiencies in mutants (e.g., Arabidopsis hcf145), where D2 levels remain stable despite PSI loss .

Comparative Analysis

FeaturePsilotum nudum psbDCyanobacterial psbD Homologs
Gene RegulationConstitutive expressionLight- and stress-inducible isoforms
Post-Translational ProcessingMinimal modificationsExtensive pD1 processing required
Stress ResponseNot characterizedIsoform switching under high light

Limitations and Future Directions

  • Species Specificity: Functional insights are extrapolated from cyanobacterial models (e.g., Synechococcus), necessitating direct studies in P. nudum .

  • Structural Data: High-resolution structures of fern PSII are lacking, hindering mechanistic comparisons with plant/cyanobacterial systems .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
psbD; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Psilotum nudum (Whisk fern) (Lycopodium nudum)
Target Names
psbD
Target Protein Sequence
MTIAIGKSSKEPKDLFDTMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFIAFHGA FGLIGFMLRQFELARSVQLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ SEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLVFPEEVLPRGNAL
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient used for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, and several subsequent electron acceptors. D2 is essential for the assembly of a stable PSII complex.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Photosystem II D2 protein in Psilotum nudum?

Photosystem II D2 protein (PsbD) in Psilotum nudum functions as a critical component of the PSII reaction center. The protein forms a heterodimer with D1, together comprising the core reaction center proteins of the PSII complex. This D1/D2 heterodimer interacts with P680 chlorophylls and subsequent electron acceptors in the photosynthetic electron transport chain . Structurally, the heterodimer binds two chlorophyll molecules and pheophytin while sharing a non-heme iron, creating the functional environment necessary for photosynthetic reactions .

The D2 protein in P. nudum, like in other photosynthetic organisms, is encoded by the plastid gene psbD. This protein has a molecular weight of approximately 39.5 kD based on nucleotide sequence analysis . Within the thylakoid membrane, D2 works in concert with other subunits to enable PSII's fundamental function: driving electron transfer from water to plastoquinone with concomitant oxygen evolution .

How does the plastid genome organization in Psilotum nudum influence psbD expression?

The plastid genome (plastome) organization in Psilotum nudum significantly influences the expression of genes like psbD. While the specific plastome structure of P. nudum is not fully detailed in the search results, research on related primitive vascular plants provides valuable insights. For instance, studies on Ophioglossum californicum, Psilotum nudum, and Equisetum hyemale have revealed ancestral land plant genome structures that impact gene expression patterns .

The presence of repeat structures within plastomes, whether inverted repeats (IR) or direct repeats (DR), has substantial implications for gene stability and expression. These repeat structures can influence the stability of gene transcripts through potential recombination events and gene duplication . In some primitive vascular plants, genome rearrangements resulting from inversions spanning repeat regions have been documented, which could potentially affect the expression of photosynthetic genes like psbD .

What is the evolutionary significance of studying psbD in Psilotum nudum compared to other land plants?

Studying psbD in Psilotum nudum offers unique evolutionary insights because P. nudum represents one of the earliest diverging vascular plant lineages. As a member of the Psilotaceae family, it possesses features that bridge the gap between non-vascular and vascular plants, making it invaluable for understanding the evolution of photosynthetic machinery across land plant evolution .

The investigation of psbD in P. nudum allows researchers to trace the conservation and divergence of photosystem components through evolutionary time. By comparing the gene sequence, protein structure, and functional characteristics of PsbD across diverse plant groups (from bryophytes to angiosperms), researchers can reconstruct the evolutionary history of this essential photosynthetic component .

Additionally, P. nudum has a unique life cycle with both photosynthetic and mycoheterotrophic phases, which presents opportunities to study how psbD expression may be regulated differently during these distinct life stages . This perspective is particularly valuable for understanding adaptation of photosynthetic machinery across evolutionary and developmental contexts.

What techniques are most effective for studying PsbD-protein interactions in the context of Psilotum nudum thylakoid membrane architecture?

Investigating PsbD-protein interactions within the native thylakoid membrane architecture of Psilotum nudum requires specialized techniques that preserve membrane integrity while allowing visualization and quantification of specific interactions. Effective methodological approaches include:

  • Proximity-based labeling techniques (BioID or APEX2) fused to PsbD to identify interacting partners in vivo

  • Single-particle cryo-electron microscopy of isolated PSII complexes to resolve structural interactions at near-atomic resolution

  • Blue-native PAGE combined with second-dimension SDS-PAGE to separate intact protein complexes before identifying components via mass spectrometry

  • Förster resonance energy transfer (FRET) microscopy using fluorescently-tagged PsbD and candidate interacting proteins

  • Crosslinking mass spectrometry (XL-MS) to capture transient interactions within the thylakoid membrane

When implementing these techniques, researchers should consider the unique properties of P. nudum thylakoids, which may differ from model plant systems. Careful optimization of membrane isolation protocols is essential, potentially adapting methods used for isolating gametophyte and sporophyte tissues from P. nudum as described in previous studies . The integration of data from multiple complementary techniques provides the most comprehensive picture of PsbD interactions within the photosynthetic apparatus.

How does homologous recombination between repeat regions in the Psilotum nudum plastome affect psbD stability and expression?

Homologous recombination between repeat regions in plant plastomes can significantly impact gene stability and expression. Although the specific structure of P. nudum's plastome is not fully detailed in the search results, insights can be drawn from studies on related species. Research on Selaginella vardei has demonstrated that homologous recombination between direct repeat (DR) regions can generate subgenomes and form diverse multimers .

This recombination process has several implications for psbD stability and expression in Psilotum nudum:

  • Potential formation of isomeric plastome arrangements that may position psbD in different genomic contexts, affecting its expression

  • Generation of subgenomic molecules with variable copy numbers of essential genes

  • Alterations in the distance between psbD and its regulatory elements, potentially modifying transcription efficiency

  • Changes in RNA secondary structure affecting transcript stability and translation efficiency

To investigate this phenomenon, researchers should employ a combination of long-read sequencing technologies (PacBio or Oxford Nanopore) to capture the full spectrum of plastome isomers present in P. nudum cells. Paired with transcriptomic and proteomic analyses, this approach can reveal how recombination events correlate with psbD expression levels and D2 protein accumulation. Additionally, researchers should examine whether environmental stressors increase recombination rates, potentially as an adaptive mechanism to modulate photosynthetic capacity.

What protocols are recommended for isolating and purifying recombinant PsbD protein from Psilotum nudum?

The isolation and purification of recombinant PsbD protein from Psilotum nudum requires a specialized protocol that accounts for the unique properties of this fern ally. Based on established techniques in photosynthesis research, the following methodological approach is recommended:

Protocol for PsbD Isolation and Purification:

  • Tissue Collection and Preparation:

    • Harvest photosynthetic sporophyte tissue from P. nudum grown under controlled conditions

    • Surface sterilize the tissue using methods similar to those described for P. nudum gametophytes

    • Flash-freeze in liquid nitrogen and grind to a fine powder

  • Gene Cloning and Expression System:

    • Amplify the psbD gene from P. nudum plastid DNA using specific primers

    • Clone into an appropriate expression vector with a His-tag or other affinity tag

    • Transform into a suitable expression system (cyanobacteria often preferred for photosynthetic proteins)

  • Membrane Protein Extraction:

    • Harvest cells and disrupt by sonication or French press

    • Isolate thylakoid membranes through differential centrifugation

    • Solubilize membranes using a mild detergent (n-dodecyl-β-D-maltoside or digitonin)

  • Affinity Chromatography:

    • Purify using nickel-NTA or cobalt-based affinity chromatography

    • Include glycerol and appropriate detergent in all buffers to maintain protein stability

    • Elute with imidazole gradient

  • Quality Assessment:

    • Verify purity via SDS-PAGE and Western blotting with antibodies against D2 protein

    • Confirm functionality through pigment binding assays and electron transport measurements

This protocol provides a foundation for obtaining purified recombinant PsbD, though optimization may be necessary depending on specific research requirements and equipment availability.

How can researchers effectively analyze the impact of mutations in the psbD gene on photosystem function?

Analyzing the impact of psbD mutations on photosystem function requires a multi-faceted approach combining molecular, biochemical, and biophysical techniques. The following methodological framework is recommended:

  • Mutation Design and Generation:

    • Use site-directed mutagenesis to introduce specific mutations based on conserved domains or hypothesized functional residues

    • Create a library of mutants targeting different structural elements of the D2 protein

    • Include naturally occurring mutations identified in psbD across different plant lineages

  • Expression System Selection:

    • For in vivo analysis, transform mutant constructs into cyanobacteria with the native psbD deleted

    • For comparative studies, express in both prokaryotic (cyanobacterial) and eukaryotic (algal or plant chloroplast transformation) systems

  • Functional Characterization:

    • Measure oxygen evolution rates under different light intensities

    • Perform chlorophyll fluorescence analysis to assess PSII quantum yield (Fv/Fm) and electron transport rate

    • Use pulse-amplitude modulation (PAM) fluorometry to measure photosynthetic parameters

    • Employ time-resolved spectroscopy to track electron transfer kinetics

  • Structural Analysis:

    • Use circular dichroism spectroscopy to assess changes in protein secondary structure

    • Perform blue-native PAGE to analyze complex assembly

    • When possible, employ cryo-electron microscopy to visualize structural alterations

  • Comparative Assessment:

    • Create a data table comparing wild-type and mutant proteins across multiple parameters:

ParameterWild-typeMutation 1Mutation 2Mutation 3
O₂ evolution rate (μmol O₂ mg⁻¹ Chl h⁻¹)xxxx
PSII quantum yield (Fv/Fm)xxxx
D1/D2 heterodimer formation (%)xxxx
Electron transfer rate (μs)xxxx
Sensitivity to photoinhibitionxxxx
Recovery rate after photodamagexxxx

This comprehensive approach allows researchers to correlate specific amino acid changes with functional outcomes, providing insights into structure-function relationships in the D2 protein.

What techniques are most reliable for studying the interaction between PsbD and arbuscular mycorrhizal fungi in Psilotum nudum?

Investigating the interaction between PsbD and arbuscular mycorrhizal fungi (AMF) in Psilotum nudum presents unique challenges due to the dual nature of P. nudum's life cycle and its mycoheterotrophic gametophyte stage. Based on established research approaches, the following methodological strategy is recommended:

  • Co-cultivation System Development:

    • Establish a controlled growth system similar to those used in previous P. nudum studies

    • Inoculate with identified AMF species known to associate with P. nudum

    • Maintain separate cultures of gametophyte and sporophyte stages for comparative analysis

  • Visualization and Localization:

    • Use light microscopy with toluidine blue staining to visualize fungal structures within plant tissues

    • Employ transmission electron microscopy to observe ultrastructural details of the plant-fungal interface

    • Implement immunogold labeling with anti-PsbD antibodies to localize the protein in relation to fungal structures

  • Expression Analysis:

    • Quantify psbD transcript levels in mycorrhizal versus non-mycorrhizal tissues using qRT-PCR

    • Perform RNA-seq to identify differential gene expression patterns in photosynthetic machinery

    • Use Western blotting to compare PsbD protein levels between mycorrhizal and non-mycorrhizal tissues

  • Functional Assessment:

    • Measure chlorophyll fluorescence parameters in tissues with varying degrees of mycorrhizal colonization

    • Analyze carbon transfer between fungus and plant using isotope labeling

    • Compare photosynthetic efficiency between mycorrhizal and non-mycorrhizal plants under different light conditions

This integrated approach enables researchers to determine whether and how AMF colonization affects PsbD expression and function in P. nudum, providing insights into the evolutionary relationship between photosynthesis and mycorrhizal symbiosis in early vascular plants.

How can researchers reconcile contradictory data regarding PsbD turnover rates in primitive vascular plants?

Contradictory data regarding PsbD turnover rates in primitive vascular plants like Psilotum nudum can be reconciled through a systematic analytical approach that considers multiple factors affecting experimental outcomes. Researchers should implement the following strategies:

  • Standardization of Experimental Conditions:

    • Create a comprehensive table documenting all experimental variables across studies:

StudyPlant AgeLight IntensityTemperatureGrowth MediumMeasurement MethodTurnover Rate
Study Ax weeksx μmol m⁻² s⁻¹x°CType xPulse-chasex h⁻¹
Study By weeksy μmol m⁻² s⁻¹y°CType yWestern bloty h⁻¹
Study Cz weeksz μmol m⁻² s⁻¹z°CType zMass specz h⁻¹
  • Meta-analysis Techniques:

    • Apply statistical meta-analysis methods to normalize data across studies

    • Calculate effect sizes rather than comparing absolute values

    • Implement random-effects models to account for between-study heterogeneity

  • Developmental Context Analysis:

    • Separate data from different developmental stages (gametophyte vs. sporophyte)

    • Consider the transition phases between mycoheterotrophic and autotrophic growth

    • Analyze whether contradictions correlate with developmental transitions

  • Methodological Validation:

    • Conduct side-by-side comparisons of different measurement techniques

    • Determine method-specific biases through calibration experiments

    • Establish correction factors for cross-study comparisons

Through this systematic approach, apparent contradictions often resolve into consistent patterns influenced by specific experimental or biological factors. Researchers should publish reconciliation analyses as valuable contributions to the field, as they establish more robust understanding of PsbD dynamics in primitive vascular plants.

What statistical approaches are most appropriate for analyzing PsbD sequence variation across Psilotum species?

Analyzing PsbD sequence variation across Psilotum species requires specialized statistical approaches that account for the evolutionary history and unique genomic features of these primitive vascular plants. The following methodological framework is recommended:

  • Sequence Alignment and Quality Control:

    • Perform multiple sequence alignment using MAFFT or similar algorithms optimized for conserved proteins

    • Apply strict quality filtering criteria to remove potentially erroneous sequences

    • Generate visual alignment inspection tools to identify problematic regions

  • Diversity and Polymorphism Analysis:

    • Calculate nucleotide diversity (π) and sequence polymorphism (θ) metrics

    • Determine the ratio of non-synonymous to synonymous substitutions (dN/dS) to assess selection pressure

    • Generate site-specific entropy plots to identify variable regions

  • Phylogenetic Analysis:

    • Implement maximum likelihood and Bayesian inference methods with appropriate evolutionary models

    • Perform bootstrap and posterior probability analyses (targeting ≥90% support values)

    • Compare tree topologies generated from psbD with those from other plastid genes

  • Population Genetics Statistics:

    • Calculate Tajima's D, Fu and Li's F, and other neutrality test statistics

    • Implement Hudson-Kreitman-Aguadé (HKA) tests for selection detection

    • Apply Bayesian skyline plot analysis for historical population size changes

  • Comparative Analysis Framework:

    • Create a data table comparing key statistical metrics across Psilotum species:

SpeciesNucleotide Diversity (π)dN/dS RatioTajima's DConserved Domains (%)Variable Sites
P. nudumxxxxx
P. complanatumyyyyy
P. flaccidumzzzzz

This comprehensive statistical approach allows researchers to distinguish between neutral evolution, positive selection, and purifying selection affecting the psbD gene across Psilotum species, providing insights into the evolutionary forces shaping photosystem II in primitive vascular plants.

How should researchers interpret differences in PsbD expression between gametophyte and sporophyte stages of Psilotum nudum?

  • Contextual Interpretation:

    • Consider the underground mycoheterotrophic nature of P. nudum gametophytes versus the photosynthetic sporophytes

    • Analyze expression differences in the context of nutritional mode transitions

    • Interpret data considering the symbiotic relationship with arbuscular mycorrhizal fungi in both stages

  • Developmental Trajectory Analysis:

    • Track PsbD expression throughout the complete life cycle, particularly during transitional phases

    • Correlate expression changes with developmental markers

    • Compare with expression patterns of other photosynthetic proteins to identify coordinated regulation

  • Functional Correlation:

    • Relate expression levels to measurable photosynthetic parameters

    • Assess whether reduced expression in gametophytes correlates with structural differences in photosynthetic apparatus

    • Evaluate the functional significance of any detected expression in mycoheterotrophic tissues

  • Evolutionary Context:

    • Compare expression patterns with those in other primitive vascular plants

    • Assess whether expression differences represent evolutionary adaptations or developmental constraints

    • Consider the ancestral state of photosystem expression in early land plants

  • Integrated Data Visualization:

    • Generate comprehensive data figures showing:

      • Absolute expression levels across life cycle stages

      • Relative abundance compared to other photosynthetic proteins

      • Correlation with photosynthetic capacity and carbon acquisition strategy

      • Comparative data from related species

By applying this integrated analytical approach, researchers can move beyond simply documenting expression differences to understanding their functional significance in the evolution and life history strategy of Psilotum nudum.

What are the most promising approaches for engineering recombinant PsbD proteins with enhanced functionality?

Engineering recombinant PsbD proteins with enhanced functionality represents a frontier in photosynthesis research. The most promising approaches for P. nudum PsbD enhancement include:

  • Directed Evolution Strategies:

    • Implement error-prone PCR to generate mutation libraries

    • Develop high-throughput screening systems based on photosynthetic efficiency

    • Apply successive rounds of selection under increasing stress conditions

    • Combine beneficial mutations identified in separate screening rounds

  • Rational Design Based on Structural Insights:

    • Target specific amino acid residues involved in electron transfer

    • Modify residues that interact with the non-heme iron to alter redox properties

    • Engineer protein-pigment interactions to optimize light harvesting

    • Strengthen D1/D2 heterodimer interfaces to enhance complex stability

  • Comparative Genomics-Guided Approach:

    • Identify natural variations in psbD across plants adapted to extreme environments

    • Transfer resilience-associated substitutions from extremophiles to P. nudum PsbD

    • Create chimeric proteins incorporating domains from species with desired properties

    • Implement ancestral sequence reconstruction to explore evolutionary innovations

  • Novel Cofactor Integration:

    • Engineer binding sites for alternative pigments with expanded spectral range

    • Modify metal-binding sites to accommodate alternative metals with different redox properties

    • Develop protein variants capable of binding synthetic cofactors with enhanced properties

Each approach offers distinct advantages, but the integration of multiple strategies typically yields the most significant improvements in protein functionality. Researchers should document both successful and unsuccessful engineering attempts to develop a comprehensive understanding of structure-function relationships in PsbD.

How might climate change affect the expression and function of PsbD in Psilotum nudum populations?

Climate change is likely to significantly impact PsbD expression and function in Psilotum nudum populations through multiple direct and indirect mechanisms. To investigate these effects, researchers should consider the following methodological framework:

  • Controlled Environment Studies:

    • Conduct factorial experiments manipulating temperature, CO₂ concentration, and water availability

    • Measure PsbD transcript abundance, protein accumulation, and turnover rates under climate change scenarios

    • Assess photosystem II efficiency and recovery from photoinhibition under combined stressors

  • Field Gradient Studies:

    • Establish research sites across natural environmental gradients representing future climate conditions

    • Compare PsbD expression and function in P. nudum populations adapted to different environments

    • Implement reciprocal transplant experiments to distinguish genetic adaptation from phenotypic plasticity

  • Molecular Evolution Analysis:

    • Compare psbD sequences from populations across climate gradients to identify adaptive variations

    • Assess whether climate-associated genetic variants show signatures of positive selection

    • Conduct experimental tests of identified variants under simulated future conditions

  • Mycorrhizal Interaction Effects:

    • Investigate how climate change affects arbuscular mycorrhizal fungi associated with P. nudum

    • Determine whether altered mycorrhizal communities influence photosynthetic gene expression

    • Assess whether mycorrhizal associations buffer or amplify climate impacts on photosynthesis

  • Predictive Modeling:

    • Develop models integrating molecular, physiological, and ecological data

    • Generate spatially explicit predictions of PsbD function under various climate scenarios

    • Identify potential refugia where photosynthetic function may be preserved under changing conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.