Recombinant Psilotum nudum Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Psilotum nudum Photosystem Q(B) Protein (psbA)

The psbA gene encodes the D1 protein, a core component of PSII responsible for water oxidation and oxygenic photosynthesis . Recombinant production enables large-scale studies of its structural stability, herbicide interactions, and repair mechanisms under photoinhibition . The Psilotum nudum variant (UniProt: Q8WI36) shares conserved motifs with higher plants but exhibits unique adaptations linked to its evolutionary position as a basal vascular plant .

Functional Role in Photosynthesis

  • Electron transport: Mediates plastoquinone (QB) binding, enabling electron transfer from pheophytin to the cytochrome b₆f complex .

  • Photoinhibition repair: Rapid turnover under light stress, with degradation rates 3–5× faster than other PSII subunits .

  • Herbicide resistance: Mutations in psbA (e.g., Ser-264→Gly) confer resistance to atrazine, as observed in cyanobacterial homologs .

Recombinant Expression and Purification

  • Expression system: Escherichia coli with N-terminal His-tag for affinity chromatography .

  • Yield: ~1.0 mg/mL post-purification, >90% purity via SDS-PAGE .

  • Stability:

    • Storage: -80°C in Tris/PBS buffer with 6% trehalose (prevents aggregation) .

    • Reconstitution: Requires glycerol (5–50%) to maintain solubility .

Applications in Research

  • Herbicide screening: Used to test binding affinities of triazines and ureas .

  • Photosynthetic assembly studies: ∆psbN mutants (e.g., in tobacco) show psbA’s dependency on assembly factors for RC integration .

  • Evolutionary studies: Comparative analysis with Solanum species highlights conserved residues critical for PSII function .

Comparative Analysis with Homologs

SpeciesUniProt IDKey DifferenceReference
Psilotum nudumQ8WI36Full-length N-terminal methionine retention
Solanum bulbocastanumQ2MIK7Substitution at position 3 (Ala→Ile)
Solanum lycopersicumQ2MIC0N-terminal methionine cleavage

Challenges and Future Directions

  • Instability: Recombinant psbA requires stringent storage conditions to prevent denaturation .

  • Functional assays: Limited data on Psilotum PSII reconstitution; most insights extrapolated from tobacco and cyanobacteria .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Psilotum nudum (Whisk fern) (Lycopodium nudum)
Target Names
psbA
Target Protein Sequence
MTATLERRESASLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, producing O₂ and a proton gradient used for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transport chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbA gene in Psilotum nudum and what function does it serve?

The psbA gene in Psilotum nudum encodes the QB protein of photosystem II, which plays a crucial role in oxygenic photosynthetic electron transport. This protein is essential for photosynthesis as it facilitates electron transfer within the photosystem II complex . The QB protein functions as an electron acceptor in the photosynthetic electron transport chain and is particularly significant because it represents a binding site for several herbicides that directly interact with the photosynthetic apparatus .

In cyanobacteria such as Anacystis nidulans, there are multiple psbA genes (three in A. nidulans) that encode slightly different versions of the QB protein . While specific information about the number of psbA genes in Psilotum nudum is not directly provided in the search results, the protein likely serves a similar fundamental role in photosynthesis across photosynthetic organisms. The conservation of this protein across evolutionary diverse photosynthetic organisms underscores its critical function in the photosynthetic machinery.

The QB protein in photosystem II represents an important component for understanding both the fundamental mechanisms of photosynthesis and the evolutionary relationships between different photosynthetic organisms, including primitive vascular plants like Psilotum nudum.

How does Psilotum nudum's evolutionary position influence the study of its photosystem components?

Psilotum nudum holds a unique evolutionary position that makes its photosystem components particularly valuable for comparative studies. As a member of Psilotales (whisk ferns), it exhibits a distinctive anatomy with conducting tissues but lacks true leaves and roots . Contrary to earlier assumptions, recent phylogenetic analyses suggest that these features represent a reduction from a more typical modern fern plant rather than the persistence of ancestral characteristics . This evolutionary context provides valuable insights when studying its photosystem components.

The evolutionary position of Psilotum nudum makes it an excellent model for understanding photosystem evolution across the plant kingdom. By comparing photosystem components like the psbA-encoded QB protein between Psilotum nudum and other organisms such as cyanobacteria, red algae, and higher plants, researchers can trace evolutionary changes in photosynthetic machinery. Such comparative analyses help elucidate how photosynthetic mechanisms have adapted and specialized across different evolutionary lineages.

Furthermore, the unique secondary metabolite profile of Psilotum nudum, including arylpyrones and biflavonoids that have been identified through various analytical techniques, provides additional context for understanding how these compounds might interact with or protect photosystem components . This integrative understanding of metabolism and photosynthetic function offers a more comprehensive view of plant physiology in an evolutionary context.

What techniques are most effective for isolating functional psbA protein from Psilotum nudum?

Isolating functional psbA protein (QB protein) from Psilotum nudum requires careful consideration of tissue selection, extraction conditions, and purification methods to maintain protein integrity. Based on research approaches used with similar photosynthetic proteins, a multi-step protocol is recommended.

Initially, researchers should select photosynthetically active tissues from above-ground portions of Psilotum nudum, focusing on the chlorenchyma cells where photosynthetic proteins are concentrated . MALDI-MS localization studies have shown that metabolites accumulate differentially in various tissues, suggesting similar tissue-specific distribution may apply to photosynthetic proteins . Fresh tissue collection and immediate processing under cold conditions (4°C) is crucial to prevent protein degradation.

For extraction, a buffer system containing 50 mM Tris-HCl (pH 7.5), 400 mM sucrose, 10 mM NaCl, 5 mM MgCl2, and protease inhibitors should be employed. Following homogenization and filtration, differential centrifugation can be used to isolate thylakoid membranes containing the photosystem II complex. Subsequent solubilization with a mild detergent like n-dodecyl β-D-maltoside (0.5-1%) helps release membrane proteins while maintaining their functionality.

For purification of recombinant psbA protein specifically, expression systems utilizing E. coli with fusion tags have proven effective for similar proteins. Drawing from methods used for PsbQ' protein expression, a system incorporating thioredoxin and 6× histidine tags facilitates efficient purification through Ni2+-NTA affinity chromatography . The fusion tags can be subsequently removed using site-specific proteases like factor Xa to obtain pure, mature protein .

The functional integrity of isolated psbA protein can be verified through oxygen evolution measurements, as demonstrated in studies of reconstituted photosystem II complexes . Additionally, redox titration and fluorescence measurements provide insights into the protein's electron transport capabilities .

What expression systems are optimal for producing recombinant Psilotum nudum psbA protein?

For recombinant expression of Psilotum nudum psbA protein, Escherichia coli-based systems offer several advantages while requiring specific optimizations to address the challenges of expressing plant membrane proteins. Based on successful approaches with similar photosynthetic proteins, a strategically designed E. coli expression system provides the most accessible and versatile platform.

The E. coli BL21(DE3) strain with pET-based vectors offers a robust foundation for expression. Drawing from methods used for successful expression of photosystem proteins like PsbQ', incorporation of solubility-enhancing fusion partners such as thioredoxin significantly improves protein folding and solubility . The addition of a 6× histidine tag facilitates efficient purification through Ni2+-NTA affinity chromatography, as demonstrated in the PsbQ' expression protocol that yielded sufficient quantities of functional protein .

Codon optimization of the Psilotum nudum psbA gene for E. coli is essential due to potential codon usage bias. Additionally, controlled expression conditions are critical - induction with IPTG at lower concentrations (0.1-0.5 mM) and reduced temperatures (16-20°C) minimizes inclusion body formation. For membrane proteins like psbA, supplementation with specific lipids or detergents in the growth medium can enhance proper folding.

Alternative expression systems may be considered for particular research objectives. Yeast systems (Pichia pastoris) offer eukaryotic post-translational modifications, while insect cell systems (baculovirus-infected Sf9 cells) provide enhanced capacity for complex membrane protein expression. For structural studies requiring native-like membrane environments, cell-free expression systems coupled with liposome incorporation represent an emerging alternative.

The purification strategy should include initial metal affinity chromatography followed by size exclusion chromatography to ensure homogeneity. Verification of proper folding and function can be assessed through redox potential measurements similar to those used to characterize photosystem II components in previous studies .

How can researchers effectively measure the redox potential of recombinant psbA protein?

Accurate measurement of redox potential is crucial for characterizing recombinant psbA protein functionality, as the QB protein plays a critical role in electron transfer within photosystem II. Based on established methodologies, several complementary approaches can be employed to effectively determine these values.

Potentiometric titration using a potentiostat represents the gold standard method, as demonstrated in studies measuring QA redox potential in photosystem II . This approach involves monitoring changes in protein fluorescence intensity as a function of applied potential. In practical implementation, researchers should prepare the recombinant psbA protein in an appropriate buffer (typically 50 mM MES-NaOH, pH 6.5) containing redox mediators that facilitate electron transfer between the electrode and protein . The experimental setup should include a reference electrode (typically Ag/AgCl), a platinum counter electrode, and a working electrode.

During measurement, incremental voltage changes are applied while recording the corresponding fluorescence intensity changes that indicate the redox state of the protein. The resulting data should be fitted to a one-electron Nernst equation, as demonstrated in the analysis of QA redox potential in cyanobacterial photosystem II, which yielded a value of -142 ± 8 mV . This mathematical treatment allows determination of the midpoint potential (Em), representing the voltage at which equal concentrations of oxidized and reduced forms are present.

For verification and complementary analysis, spectroelectrochemical methods combining UV-visible spectroscopy with electrochemistry can be employed. Additionally, thermoluminescence measurements provide valuable insights into the energetics of electron transfer reactions involving the QB binding site . This technique involves monitoring light emission from recombination of charged species as a sample is heated at a controlled rate after illumination at low temperature.

To ensure reliability, measurements should be performed under anaerobic conditions to prevent interference from oxygen, and multiple independent measurements should be conducted to establish reproducibility. The reversibility of the redox reaction should be confirmed over several hours during experiments, as noted in studies of QA redox potential in photosystem II .

What techniques should be used to analyze the interaction between recombinant psbA protein and herbicides?

Analyzing interactions between recombinant psbA protein and herbicides requires multiple complementary approaches to comprehensively characterize binding affinities, structural details, and functional consequences. As the QB protein encoded by psbA genes serves as a target for several herbicides that act by binding directly to the photosynthetic apparatus , understanding these interactions is valuable for both fundamental research and agricultural applications.

Surface plasmon resonance (SPR) provides a powerful label-free method for quantifying binding kinetics and affinities. The recombinant psbA protein should be immobilized on a sensor chip through amine coupling or capturing via incorporated affinity tags. Herbicides at varying concentrations are then flowed over the immobilized protein, allowing real-time monitoring of association and dissociation rates. This approach enables determination of kinetic parameters (kon and koff) and equilibrium dissociation constants (KD) that quantitatively describe binding strength.

Isothermal titration calorimetry (ITC) offers complementary thermodynamic information about binding interactions. By measuring heat changes during titration of herbicide into a solution containing recombinant psbA protein, researchers can determine binding stoichiometry, enthalpy changes (ΔH), and entropy contributions (ΔS) in addition to binding affinity (KD). These parameters provide mechanistic insights into the driving forces behind herbicide-protein interactions.

Functional consequences of herbicide binding can be assessed through measurements of electron transport activity. By monitoring oxygen evolution activity in reconstituted systems containing the recombinant psbA protein, researchers can construct dose-response curves for various herbicides . The experimental setup should parallel methods used for oxygen evolution measurements in photosystem II studies, where rates around 1500 μmol(O2) mg(Chl)−1 h−1 have been observed in functional systems .

For structural characterization of herbicide binding sites, hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers detailed insights without requiring protein crystallization. This technique identifies regions of the protein that become protected from solvent exchange upon herbicide binding, thereby mapping interaction interfaces.

How does the psbA gene family in Psilotum nudum compare to that in cyanobacteria and other photosynthetic organisms?

The psbA gene family exhibits fascinating evolutionary patterns across photosynthetic organisms, with significant variations in gene number, sequence, and regulation that provide insights into photosynthetic adaptation. Comparing these patterns between Psilotum nudum and other organisms reveals both conserved features and lineage-specific adaptations.

In cyanobacteria such as Anacystis nidulans R2, the genome contains three distinct psbA genes encoding the QB protein of photosystem II . These genes (psbAI, psbAII, and psbAIII) produce transcripts at different steady-state levels in wild-type cells, suggesting differential regulation . Interestingly, psbAII and psbAIII encode proteins with identical amino acid sequences, while the protein encoded by psbAI differs by 25 out of 360 residues . Functional studies through gene inactivation have demonstrated that each gene is independently capable of producing sufficient QB protein to support normal photoautotrophic growth, indicating functional redundancy .

While the search results don't provide specific details about the psbA gene family in Psilotum nudum, we can infer patterns based on evolutionary relationships. As a primitive vascular plant, Psilotum nudum likely has fewer psbA gene copies than cyanobacteria, possibly having undergone gene family contraction during evolution from algal ancestors. This pattern would align with observations in other photosynthetic lineages where gene family complexity often changes during evolutionary transitions.

The amino acid sequences surrounding the QB binding site are likely highly conserved across species due to functional constraints. This conservation is exemplified in red algae and cyanobacteria, where the amino acids surrounding the QA (a related component) are entirely conserved between Cyanidioschyzon merolae and Thermosynechococcus elongatus despite other differences in their photosystem II complexes .

Regulatory mechanisms governing psbA expression likely differ between Psilotum nudum and cyanobacteria, reflecting adaptation to different environmental conditions. In cyanobacteria, the multiple psbA genes allow for differential regulation under varying light conditions and during stress responses, a feature that may be achieved through different mechanisms in Psilotum nudum.

What metabolomic approaches can reveal the relationship between psbA function and secondary metabolite production in Psilotum nudum?

Investigating the relationship between psbA function and secondary metabolite production in Psilotum nudum requires sophisticated metabolomic approaches coupled with manipulations of photosynthetic activity. Such integrated studies can illuminate how photosynthetic electron transport influences the plant's distinctive metabolic profile and stress responses.

Gas Chromatography-Mass Spectrometry (GC-MS) and High Performance Liquid Chromatography-Quadrupole Time of Flight-Mass Spectrometry (HPLC-QTOF-MS) provide comprehensive metabolite profiling capabilities, as demonstrated in previous studies of Psilotum nudum . These techniques have successfully identified arylpyrones and biflavonoids as prominent constituents in Psilotum tissues . For targeted analysis of compounds potentially linked to photosynthetic function, researchers should implement Multiple Reaction Monitoring (MRM) to enhance sensitivity for specific metabolites of interest.

Nuclear Magnetic Resonance (NMR) spectroscopy offers complementary structural confirmation of metabolites and has been successfully applied to characterize compounds from Psilotum nudum . This approach is particularly valuable for elucidating novel structures that may emerge under conditions of altered photosynthetic function.

To establish causal relationships between psbA function and metabolite production, experimental manipulations of photosynthetic activity are essential. These can include controlled application of herbicides that specifically target the QB protein (encoded by psbA genes) , light intensity modulations, or genetic approaches to alter psbA expression levels. Following such treatments, time-course metabolomic analyses can reveal dynamic changes in metabolite profiles directly attributable to altered photosynthetic function.

Spatial localization of metabolites provides crucial context for understanding their relationship to photosynthetic processes. Matrix-Assisted Laser Desorption/Ionization-Mass Spectrometry (MALDI-MS) has been successfully applied to localize metabolites within Psilotum tissues, revealing preferential accumulation of arylpyrone glycosides and biflavonoid aglycones in cells of the chlorenchyma . This technique can be expanded to correlate metabolite distributions with regions of active photosynthesis.

Data integration and analysis benefit from multivariate statistical approaches such as Principal Component Analysis (PCA), which has successfully differentiated Psilotum tissue types based on their metabolite profiles . The application of this approach to samples with manipulated psbA function can reveal metabolic signatures specifically associated with alterations in photosynthetic electron transport.

What strategies can overcome challenges in crystallizing recombinant Psilotum nudum psbA protein for structural studies?

Crystallizing membrane proteins like the psbA-encoded QB protein presents significant challenges that require specialized approaches to overcome the inherent difficulty of working with hydrophobic transmembrane regions. A multi-faceted strategy combining protein engineering, optimized crystallization conditions, and alternative structural methods offers the best path toward high-resolution structural characterization.

Protein engineering approaches should focus on enhancing protein stability and crystallizability while maintaining native structure. Creating fusion constructs with crystallization chaperones such as T4 lysozyme or BRIL (apocytochrome b562RIL) can provide additional hydrophilic surfaces for crystal contacts. Based on successful approaches with other membrane proteins, these fusion partners should be inserted into predicted loop regions away from the QB binding site and transmembrane domains. Additionally, targeted surface entropy reduction through mutation of flexible surface residues (particularly lysine and glutamate clusters) to alanines can promote more ordered crystal packing.

Detergent screening is crucial for membrane protein crystallization. A systematic evaluation of detergents ranging from harsh (SDS, LDAO) to mild (DDM, LMNG) should be conducted using size-exclusion chromatography to identify conditions that maintain protein monodispersity. The lipid cubic phase (LCP) method offers an alternative approach that has proven successful for photosystem proteins, where the protein is reconstituted into a lipidic mesophase that mimics the native membrane environment.

Crystallization condition optimization should employ sparse matrix screens followed by targeted optimization around promising conditions. The addition of specific lipids that co-purify with the protein or are known to interact with photosystem II components can stabilize the protein structure. Temperature is a critical variable, with many membrane proteins crystallizing more readily at lower temperatures (4-16°C) that reduce protein flexibility.

When traditional crystallography proves challenging, alternative approaches should be considered. Cryo-electron microscopy (cryo-EM) has revolutionized structural studies of membrane proteins and doesn't require crystallization. This approach is particularly valuable for larger complexes where the psbA-encoded protein is assembled with other photosystem II components. X-ray free-electron laser (XFEL) crystallography allows collection of diffraction data from microcrystals and has been successfully applied to photosystem studies.

How can site-directed mutagenesis be used to investigate the functional domains of Psilotum nudum psbA protein?

Site-directed mutagenesis represents a powerful approach for dissecting the structure-function relationships in the psbA-encoded QB protein, allowing researchers to precisely map functional domains and critical residues involved in electron transport, herbicide binding, and protein-protein interactions. A comprehensive mutagenesis strategy should target several key functional regions with specific hypotheses.

The QB binding pocket should be systematically investigated through alanine scanning mutagenesis of residues predicted to line this critical functional site. Based on knowledge that the QB protein serves as the target for several herbicides that bind directly to the photosynthetic apparatus , mutations in this region would be expected to alter both herbicide sensitivity and electron transfer kinetics. Specific residues identified in other species, particularly those that differ between organisms with varying herbicide sensitivities, should be prioritized. Following mutagenesis, herbicide binding assays using methods described earlier can quantify changes in binding affinity.

The interface between the QB protein and other photosystem II components represents another critical target region. Mutations at predicted interaction surfaces can reveal residues essential for assembly and stability of the photosystem complex. The functional consequences of these mutations can be assessed through co-immunoprecipitation assays to detect changes in protein-protein interactions and oxygen evolution measurements to evaluate impacts on electron transport efficiency .

Transmembrane helices of the QB protein likely contain residues crucial for anchoring the protein within the thylakoid membrane and maintaining its proper orientation. Targeted mutations within these regions, particularly of highly conserved residues, can provide insights into structural requirements for protein stability and function. Protein topology analysis following mutagenesis, using protease accessibility assays, can confirm effects on membrane insertion and orientation.

For each mutation, functional characterization should include redox potential measurements using methods described previously . Changes in redox potential resulting from specific mutations would provide direct evidence for the role of particular residues in electron transfer functions. Complementary thermoluminescence measurements can reveal alterations in the energetics of charge recombination reactions within photosystem II .

A particularly valuable approach involves creating chimeric proteins where segments of the Psilotum nudum psbA protein are replaced with corresponding regions from species with different functional properties, such as cyanobacteria with multiple psbA genes . Such chimeras can identify regions responsible for species-specific functional differences.

What are the most promising approaches for studying the temporal regulation of psbA gene expression in Psilotum nudum?

Investigating the temporal regulation of psbA gene expression in Psilotum nudum requires integrated approaches that capture dynamic transcriptional, translational, and post-translational processes across different time scales and environmental conditions. Several complementary methodologies offer comprehensive insights into these regulatory mechanisms.

RNA-Seq with high temporal resolution provides the foundation for understanding transcriptional dynamics. Time-course experiments capturing psbA transcript levels across diurnal cycles (every 2-4 hours over 24-48 hours) can reveal circadian patterns of expression. This approach should be extended to include varying light intensities, spectral compositions, and stress conditions (drought, temperature fluctuations) that might trigger regulatory responses. Nascent RNA sequencing techniques, which specifically capture actively transcribed RNAs, offer enhanced sensitivity to rapid transcriptional changes.

Transcription factor identification and characterization are essential for understanding the regulatory network controlling psbA expression. Chromatin immunoprecipitation sequencing (ChIP-seq) can identify binding sites for transcription factors at the psbA promoter regions, while DNA affinity purification sequencing (DAP-seq) provides a complementary approach for identifying DNA-binding proteins that interact with these regulatory regions. Yeast one-hybrid assays can further validate these interactions in a controlled system.

Translational regulation can be assessed through ribosome profiling (Ribo-seq), which quantifies ribosome-associated mRNAs to indicate translation rates of psbA transcripts. Polysome profiling provides complementary information about translation efficiency by separating mRNAs based on the number of associated ribosomes. These approaches should be applied across the same temporal and environmental conditions used for transcriptional studies to capture regulatory disconnects between transcript abundance and protein synthesis.

Post-translational regulation, particularly important for photosystem proteins where turnover and repair are critical processes, can be investigated through pulse-chase experiments combined with mass spectrometry. Selective reaction monitoring (SRM) or parallel reaction monitoring (PRM) mass spectrometry approaches enable precise quantification of psbA protein levels over time.

For integrating multiple regulatory layers, mathematical modeling approaches such as ordinary differential equations (ODEs) can describe the dynamic relationships between transcription, translation, protein assembly, and degradation rates. These models should incorporate feedback mechanisms where photosystem function influences gene expression, creating a systems-level understanding of psbA regulation.

How does the amino acid composition of psbA protein compare between Psilotum nudum and other photosynthetic organisms?

The amino acid composition and sequence conservation of the psbA-encoded QB protein across photosynthetic organisms reveals evolutionary patterns that reflect both functional constraints and adaptations to different ecological niches. While specific data for Psilotum nudum psbA protein is not directly provided in the search results, comparative analysis can be constructed based on available information about related photosynthetic organisms.

OrganismTaxonomic GrouppsbA Protein LengthKey Functional RegionsNotable Amino Acid FeaturesReference
Anacystis nidulans R2 (psbAI)Cyanobacteria360 residuesQB binding pocket, Transmembrane helices25 amino acid differences from psbAII/III
Anacystis nidulans R2 (psbAII/III)Cyanobacteria360 residuesQB binding pocket, Transmembrane helicesIdentical amino acid sequence between these isoforms
Thermosynechococcus elongatusCyanobacteria~360 residuesQA binding regionConserved residues around QA binding site
Cyanidioschyzon merolaeRed alga~360 residuesQA binding regionConserved residues around QA site identical to T. elongatus
Psilotum nudum (predicted)Whisk fern~360 residuesQB binding pocket, Transmembrane helicesLikely conservation in functional domains with specific adaptations in variable regions

In cyanobacteria like Anacystis nidulans R2, the presence of multiple psbA genes with different sequences suggests functional specialization . The psbAI gene encodes a protein that differs from the psbAII/III-encoded protein by approximately 7% of its amino acids (25 out of 360 residues) . This degree of divergence likely reflects adaptations to different light conditions or other environmental factors while maintaining core functionality.

The amino acid sequences surrounding critical functional regions, such as the QA binding site, show remarkable conservation across diverse photosynthetic lineages. As noted in the search results, the amino acids surrounding the QA are entirely conserved between the red alga Cyanidioschyzon merolae and the cyanobacterium Thermosynechococcus elongatus . This conservation highlights the stringent functional constraints on residues directly involved in electron transfer reactions.

Based on evolutionary patterns observed in other photosynthetic proteins, we can predict that the Psilotum nudum psbA protein likely shows high sequence conservation in core functional domains while exhibiting lineage-specific adaptations in more variable regions. As a primitive vascular plant with unique evolutionary history, Psilotum nudum may contain signature amino acid substitutions that reflect its specific photosynthetic adaptations.

The conservation pattern across species correlates with functional importance – transmembrane helices and electron transfer centers show the highest conservation, while stromal and lumenal loops typically display greater variability. This pattern underscores the fundamental importance of maintaining proper electron transfer function while allowing adaptation in more flexible regions of the protein.

What evidence supports the functional redundancy of multiple psbA genes in photosynthetic organisms?

Strong experimental evidence supports the functional redundancy of multiple psbA genes in photosynthetic organisms, though with subtle specializations that likely provide adaptive advantages under varying environmental conditions. This redundancy represents an important evolutionary strategy for maintaining photosynthetic function despite damage to photosystem II components.

In the cyanobacterium Anacystis nidulans R2, definitive evidence for functional redundancy comes from targeted gene inactivation studies. Researchers systematically inactivated each of the three psbA genes (psbAI, psbAII, and psbAIII) in the Anacystis chromosome, both singly and in pairs . These experiments demonstrated that each of the genes independently is capable of producing sufficient functional QB protein to support normal photoautotrophic growth . This finding provides direct evidence that the multiple gene copies can functionally substitute for one another under standard growth conditions.

OrganismNumber of psbA GenesExperimental ApproachKey FindingsReference
Anacystis nidulans R23 (psbAI, psbAII, psbAIII)Targeted gene inactivationEach gene independently supports photoautotrophic growth
Anacystis nidulans R23 (psbAI, psbAII, psbAIII)Transcript analysisDifferent steady-state levels of transcripts from each gene
Thermosynechococcus elongatusTypically multipleRedox potential measurementsBaseline QA redox potential of -142 ± 8 mV
Cyanidioschyzon merolae (red alga)Typically fewer than cyanobacteriaComparative redox analysisQA redox potential 40 mV higher than cyanobacteria

Despite this redundancy, there is evidence for differential expression and potential specialization of psbA genes. The transcripts from the three Anacystis psbA genes are present in wild-type cells at different steady-state levels , suggesting differential regulation that may reflect specialization for different environmental conditions or developmental stages. This variation in expression levels indicates that while the genes are functionally redundant, they may be preferentially utilized under different circumstances.

The sequence differences between psbA genes further support the notion of subtle functional specialization. In Anacystis, psbAII and psbAIII encode proteins with identical amino acid sequences, while the psbAI gene encodes a protein that differs by 25 out of 360 residues . These sequence differences likely confer slightly different properties to the proteins, potentially optimizing them for different light conditions, temperature ranges, or other environmental variables.

The functional significance of having multiple psbA genes likely relates to the high susceptibility of the D1 protein (encoded by psbA) to photodamage. The PSII reaction center, particularly the D1 protein, experiences frequent damage during photosynthesis and requires regular replacement. Multiple gene copies with differential regulation provide a mechanism for maintaining adequate D1 protein levels despite continuous turnover, particularly under stressful conditions that accelerate photodamage.

How do redox potential measurements compare between native and recombinant psbA proteins across species?

Redox potential measurements of native and recombinant photosystem proteins reveal significant variations across species and conditions, providing valuable insights into the functional properties of these electron transport components. These measurements help elucidate how structural differences and protein-protein interactions influence the energetics of photosynthetic electron transport.

Organism/Protein TypePhotosystem ComponentRedox Potential (mV)Measurement MethodExperimental ConditionsReference
Thermosynechococcus elongatus (cyanobacterium)QA in native PSII-142 ± 8Potentiometric titrationControl PSII
T. elongatus with reconstituted PsbQ'QA in modified PSII-110 ± 6Potentiometric titrationPsbQ'-reconstituted PSII
Cyanidioschyzon merolae (red alga)QA in native PSII~40 mV higher than T. elongatusComparative analysisNative PSII with PsbQ'
Higher plants (spinach, pea)QA in native PSIITypically between -170 and -160 mVReferenced valuesNative PSII

Significant species-dependent variations in redox potential have been documented for photosystem components. The redox potential of QA in PSII from the cyanobacterium Thermosynechococcus elongatus was measured at approximately -140 mV, while in higher plants like spinach and pea, values typically range between -170 and -160 mV . These differences reflect evolutionary adaptations in the photosynthetic apparatus across diverse photosynthetic lineages.

The impact of protein-protein interactions on redox potential is clearly demonstrated in reconstitution experiments. When the PsbQ' protein from red algae was reconstituted with cyanobacterial PSII, the redox potential of QA shifted positively by approximately 32 mV, from -142 ± 8 mV to -110 ± 6 mV . This significant shift occurred despite no changes in the amino acid sequence surrounding QA, which is entirely conserved between red algae and cyanobacteria . This observation highlights how extrinsic proteins can influence the electronic properties of photosystem components through long-range interactions or conformational changes.

Recombinant proteins generally aim to replicate the properties of their native counterparts, but differences can arise due to post-translational modifications, protein folding environments, or the absence of native interaction partners. In reconstitution experiments, the PsbQ' protein was expressed in E. coli as a fusion protein with thioredoxin and a 6× histidine tag, then purified and processed to remove these tags before reconstitution with PSII . The resulting recombinant PsbQ' successfully attached to cyanobacterial PSII and altered its redox properties, demonstrating that properly expressed and processed recombinant proteins can exhibit functional properties comparable to native proteins.

The methodology for measuring redox potentials is highly standardized, enabling reliable comparisons across studies. Potentiometric titrations involving monitoring fluorescence intensity changes as a function of applied voltage represent the established approach . The resulting data are typically fitted to a one-electron Nernst equation to determine the midpoint potential, as demonstrated in studies of QA redox potential .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.