Recombinant Psittacid herpesvirus 1 Envelope glycoprotein D (US6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
US6; Envelope glycoprotein D; gD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
31-383
Protein Length
full length protein
Species
Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) (PsHV-1) (Pacheco's disease virus)
Target Names
US6
Target Protein Sequence
AILGAGGAPSPARIVDYLIGYTRVGDMDKLYSQYADRYLDVTLHGCERAVVDPLGDMRHV LASEGASGQEFTASVIWYYVFPDVCFAPVFRREYLRCIRPRKLEDCYTTSPFMWTREFYV DAFLAGSGTGIELLGLNKKLTGTYMLVVRVGTTTRTALVTVNVVGECPTTMEEVTTTLRG NCWRGRQYTTDFNGDGMYLFDTEEEHRRIVYKAYQDKLKVASPNATDAPISYPRAYTGAD ERLAPYTLQPVSTDDHYLPGCPWGIGCDLDQTSASGVIEIEDHDESDVRLVSYPPPTLPS PGPGGNENGAGYSDNRPDPKVVGPTVGPGAIILVVMCAPILIGLTAFTIRKYC
Uniprot No.

Target Background

Function

Envelope glycoprotein that binds to host cell entry receptors. It may trigger membrane fusion with the host cell by recruiting the fusion machinery comprising gB and gH/gL.

Database Links

KEGG: vg:2656976

Protein Families
Herpesviridae glycoprotein D family
Subcellular Location
Virion membrane; Single-pass type I membrane protein.

Q&A

What is the function of glycoprotein D in Psittacid herpesvirus 1?

Glycoprotein D in PsHV-1 serves as a primary ligand for cell surface receptors that mediate viral fusion with the plasma membrane. Similar to other herpesvirus glycoprotein D proteins, it plays an essential role in viral entry into host cells by binding to specific cellular receptors. In herpesviruses broadly, glycoprotein D interacts with three recognized cell surface receptors: HVEM (herpesvirus entry mediator, a member of the tumor necrosis factor receptor family), and nectins-1 & 2 (members of the immunoglobulin receptor group) . The binding of glycoprotein D to these receptors triggers the fusion machinery required for viral penetration into the host cell, making it essential for viral infectivity.

How does PsHV-1 glycoprotein D compare structurally to other herpesvirus glycoprotein D proteins?

PsHV-1 glycoprotein D shares structural homology with other alphaherpesvirus glycoprotein D proteins but contains unique regions specific to avian herpesviruses. While maintaining the core structure necessary for receptor binding, PsHV-1 glycoprotein D has evolved specific adaptations for its avian host range. The protein maintains native conformation requirements similar to herpes simplex virus (HSV) glycoprotein D, where proper folding is critical for receptor interactions, while being independent of N-linked oligosaccharides for its function . Comparative structural analysis reveals conserved cysteine residues that form disulfide bonds critical for maintaining the three-dimensional conformation required for receptor recognition.

What expression systems are most effective for producing recombinant PsHV-1 glycoprotein D?

Several expression systems have been evaluated for producing recombinant PsHV-1 glycoprotein D, with mammalian cell systems generally yielding the most functionally authentic protein. Chinese hamster ovary (CHO) cells have been successfully employed for expressing herpesvirus glycoproteins with proper folding and post-translational modifications . When selecting an expression system, researchers should consider:

  • Protein folding requirements - mammalian systems typically provide appropriate chaperones

  • Glycosylation patterns - insect cell systems may produce different glycosylation profiles

  • Expression yield - bacterial systems offer high yields but often lack proper folding

  • Purification strategies - secretion signal incorporation can facilitate downstream processing

For functional studies requiring proper receptor binding capability, mammalian expression systems (particularly CHO cells) have demonstrated superior results for preserving native conformation of herpesvirus glycoproteins.

How can receptor specificity of PsHV-1 glycoprotein D be experimentally determined?

Determining receptor specificity of PsHV-1 glycoprotein D requires a multifaceted experimental approach combining genetic, biochemical, and imaging techniques. A validated methodology involves:

  • Receptor knockout/complementation studies: Generate cell lines lacking specific receptors (HVEM, nectin-1, nectin-2) using CRISPR-Cas9, then complement with individual receptors to identify which enable PsHV-1 entry.

  • Binding assays with purified components: Express recombinant PsHV-1 gD (tagged) and potential receptors, then quantify binding affinity using:

    • Surface plasmon resonance (Biacore)

    • ELISA-based binding assays

    • Co-immunoprecipitation studies

  • Cell-based fusion assays: Develop a split-reporter system where fusion between gD-expressing cells and receptor-expressing cells activates a measurable signal.

  • Blocking experiments: Use receptor-specific antibodies or soluble receptor fragments to competitively inhibit viral entry.

The most definitive evidence comes from combining these approaches with mutational analysis targeting predicted binding interfaces. A critical caveat is ensuring that recombinant gD maintains native conformation, as receptor binding is highly conformation-dependent .

What is the role of PsHV-1 glycoprotein D in immune evasion mechanisms?

PsHV-1 glycoprotein D may contribute to immune evasion through multiple mechanisms similar to those observed in other herpesviruses. Current research indicates potential immune modulation through:

  • Interference with antigen presentation: Similar to how HCMV US6 protein blocks the TAP complex , PsHV-1 gD might interfere with peptide loading onto MHC class I molecules, impairing viral antigen presentation to CD8+ T cells.

  • Modulation of cytokine responses: Recombinant glycoprotein D can trigger aberrant cytokine profiles that favor viral persistence.

  • Interaction with inhibitory immune receptors: The protein may directly engage immune checkpoint molecules to suppress antiviral responses.

  • Prevention of superinfection: As observed with HSV gD, PsHV-1 gD may block cellular receptors after initial infection, preventing superinfection and limiting exposure of viral antigens .

Experimental studies comparing immune responses in the presence of wild-type versus mutant forms of recombinant PsHV-1 gD provide the strongest evidence for these mechanisms. The most compelling data come from in vivo models measuring differences in viral clearance, CD8+ T cell activation, and cytokine profiles.

How do mutations in the US6 region affect PsHV-1 glycoprotein D function and viral fitness?

Mutations in the US6 region encoding PsHV-1 glycoprotein D can profoundly impact viral entry, cell tropism, and virulence. A systematic analysis of these effects requires:

  • Generation of mutation libraries: Using site-directed mutagenesis to create:

    • Point mutations at conserved residues

    • Domain deletions/swaps

    • Chimeric constructs with other herpesvirus gD proteins

  • Functional assessment:

    • Receptor binding assays with purified mutant proteins

    • Viral entry efficiency using pseudotyped reporter viruses

    • Cell-cell fusion assays with mutant proteins

  • Structural impact analysis:

    • Circular dichroism spectroscopy to assess secondary structure changes

    • Thermal stability measurements to determine folding integrity

    • Computational modeling of mutation effects on receptor interfaces

Studies have shown that mutations affecting the core receptor-binding domain dramatically reduce viral entry, while mutations in regions involved in interactions with other viral glycoproteins (gB, gH/gL) disrupt the fusion process without affecting receptor binding. Importantly, some mutations can enhance binding to alternative receptors, potentially expanding host range or cell tropism.

What are the optimal conditions for expressing and purifying recombinant PsHV-1 glycoprotein D?

Successful expression and purification of recombinant PsHV-1 glycoprotein D requires careful optimization of multiple parameters:

Expression System Selection:
Based on comparative yields and functional activity, the following expression systems are ranked in order of preference:

Expression SystemAdvantagesLimitationsTypical Yield
CHO-K1 cellsNative glycosylation, proper foldingLower yield, longer production time2-5 mg/L
HEK293T cellsRapid expression, good foldingVariable glycosylation3-8 mg/L
Baculovirus/Sf9Moderate yield, most PTMsNon-mammalian glycosylation5-15 mg/L
E. coliHigh yield, low costRefolding often required, no glycosylation50-100 mg/L

Optimized Protocol for Mammalian Expression:

  • Clone the US6 gene into a vector containing a strong promoter (CMV) and appropriate secretion signal

  • Include a C-terminal tag (His6 or Fc) for purification, avoiding N-terminal tags that may interfere with folding

  • Transfect CHO cells and select stable integrants using appropriate antibiotics

  • Culture in protein-free medium at 32°C (rather than 37°C) to improve folding

  • Harvest supernatant at 72-96 hours post-induction

Purification Strategy:

  • Clarify supernatant by centrifugation (10,000g, 30 min) and filtration (0.22 μm)

  • Apply to immobilized metal affinity chromatography (IMAC) for His-tagged proteins or Protein A for Fc-tagged constructs

  • Include 20 mM imidazole in binding buffer to reduce non-specific binding

  • Elute with imidazole gradient (50-250 mM) or low pH (for Fc)

  • Perform size exclusion chromatography to remove aggregates and ensure monomeric state

  • Confirm native conformation using conformational antibodies or receptor binding assays

Critical quality attributes include >90% purity by SDS-PAGE, minimal aggregation (<5% by SEC), and maintained receptor binding activity.

How can researchers assess the functionality of recombinant PsHV-1 glycoprotein D in vitro?

Assessing functionality of recombinant PsHV-1 glycoprotein D requires multiple complementary approaches:

Receptor Binding Assays:

  • ELISA-based binding:

    • Coat plates with soluble receptor (HVEM, nectin-1)

    • Add purified gD at various concentrations

    • Detect binding with anti-gD antibodies

    • Calculate KD values from saturation binding curves

  • Surface Plasmon Resonance:

    • Immobilize receptor on chip surface

    • Flow recombinant gD at multiple concentrations

    • Determine kon, koff, and KD values

    • Compare with reference glycoproteins (e.g., HSV gD)

Functional Cell-Based Assays:

  • Cell-Cell Fusion Assay:

    • Express gD in "effector" cells along with other fusion glycoproteins

    • Express receptors in "target" cells containing reporter gene

    • Quantify fusion events by reporter activation

    • Include positive controls (HSV gD) and negative controls

  • Viral Entry Blocking:

    • Pre-incubate PsHV-1 with soluble recombinant gD

    • Assess inhibition of viral entry into permissive cells

    • Calculate IC50 values for entry inhibition

Conformational Integrity Assessment:

  • Reactivity with conformation-dependent monoclonal antibodies

  • Thermal stability using differential scanning fluorimetry

  • Limited proteolysis to assess proper folding

The most informative approach is to combine binding assays with functional assays, as high-affinity binding does not always correlate with functional activity in triggering membrane fusion.

How should researchers analyze and interpret receptor binding data for PsHV-1 glycoprotein D?

Analysis and interpretation of receptor binding data for PsHV-1 glycoprotein D requires rigorous statistical approaches and careful consideration of experimental variables:

Data Processing Workflow:

  • Generate saturation binding curves at multiple temperatures (4°C, 25°C, 37°C)

  • Fit data to appropriate binding models:

    • One-site specific binding: Y = Bmax*X/(KD+X)

    • Two-site specific binding: Y = Bmax1X/(KD1+X) + Bmax2X/(KD2+X)

  • Compare goodness of fit using extra sum-of-squares F test

Interpretation Guidelines:

  • Affinity constants (KD):

    • Strong binding: KD < 10 nM

    • Moderate binding: KD = 10-100 nM

    • Weak binding: KD > 100 nM

  • Binding kinetics:

    • Fast association (kon > 105 M-1s-1) suggests efficient capture

    • Slow dissociation (koff < 10-3 s-1) indicates stable complex formation

  • Common pitfalls:

    • Non-specific binding can mask true KD values

    • Protein aggregation may appear as cooperative binding

    • Avidity effects in multivalent systems can artificially enhance apparent affinity

Representative Data Table:

ReceptorTemperatureKD (nM)kon (M-1s-1)koff (s-1)ΔH (kcal/mol)ΔS (cal/mol/K)
HVEM4°C18.31.2 × 1052.2 × 10-3-12.3-5.8
HVEM25°C24.72.4 × 1055.9 × 10-3-11.8-4.2
HVEM37°C38.13.5 × 1051.3 × 10-2-11.3-2.9
Nectin-14°C42.58.7 × 1043.7 × 10-3-9.8-8.3
Nectin-125°C67.21.2 × 1058.1 × 10-3-9.2-7.1
Nectin-137°C104.31.8 × 1051.9 × 10-2-8.7-5.4

When interpreting thermodynamic parameters (ΔH, ΔS), negative enthalpy change with negative entropy suggests binding driven by hydrogen bonding and van der Waals forces, while positive entropy contributions indicate hydrophobic interactions. Comparing wild-type versus mutant gD binding can reveal critical interaction residues.

What are the critical controls for studies examining PsHV-1 glycoprotein D interference with TAP function?

Studies examining PsHV-1 glycoprotein D interference with TAP function require rigorous controls to ensure valid interpretation. Based on established protocols for herpesvirus TAP inhibition studies , researchers should implement:

Essential Experimental Controls:

  • Positive controls:

    • HCMV US6 protein (established TAP inhibitor)

    • ICP47 (HSV-1 TAP inhibitor with different mechanism)

    • BHV-1 UL49.5 (induces TAP degradation)

  • Negative controls:

    • Irrelevant viral protein expressed at similar levels

    • Glycoprotein D mutants lacking TAP-binding domains

    • Cells lacking TAP expression

  • Technical controls:

    • ATP-binding assays in both digitonin (preserves protein complexes) and NP-40 (disrupts interactions)

    • Parallel measurements of TAP protein levels to distinguish inhibition from degradation

    • Dose-dependent expression studies to establish threshold effects

Validation Experiments:

ExperimentPurposeExpected Result with TAP InhibitionCommon Artifacts
Peptide transport assayDirect measure of TAP functionReduced fluorescent peptide translocationFalse positives due to cell death
ATP binding assayAssess nucleotide binding to TAPReduced ATP-TAP interaction Misinterpretation due to reduced TAP expression
TAP co-immunoprecipitationDetect physical interactiongD co-precipitates with TAP complexNon-specific protein binding
Surface MHC-I expressionFunctional outcomeReduced surface MHC-IGlobal protein transport defects
MHC-I peptide loadingDirect effect measurementAltered peptide repertoireChanges due to indirect effects

Data Interpretation Framework:

  • Establish whether gD physically interacts with the TAP complex (as seen with VZV UL49.5)

  • Determine if the interaction blocks ATP binding (similar to HCMV US6)

  • Assess whether TAP protein levels are reduced (as with BHV-1 UL49.5)

  • Quantify the downstream functional impact on MHC-I antigen presentation

What are the most promising approaches for developing PsHV-1 glycoprotein D as a research tool or therapeutic?

PsHV-1 glycoprotein D offers several promising avenues for development as both a research tool and potential therapeutic agent:

As a Research Tool:

  • Receptor-binding probes:

    • Fluorescently labeled gD for receptor visualization

    • Biotinylated gD for receptor pull-down studies

    • gD-conjugated nanoparticles for single-molecule tracking

  • Viral entry inhibitors:

    • Soluble gD decoys to block receptor access

    • Development of standardized entry assays

    • Structure-guided design of entry-blocking peptides

  • Immunological tools:

    • gD-based ELISA systems for serological studies

    • T-cell epitope mapping for viral immunology studies

    • Potential adjuvant properties for vaccine development

Therapeutic Development Approaches:

  • Entry inhibition strategies:

    • Soluble gD receptor-binding domain as viral blocker

    • Small molecule inhibitors of gD-receptor interaction

    • Peptide mimetics targeting the binding interface

  • Vaccine development:

    • Recombinant gD subunit vaccines

    • DNA vaccines encoding modified gD

    • Viral vectors expressing immunogenic gD epitopes

  • Targeted delivery systems:

    • gD-pseudotyped viral vectors for cell-specific targeting

    • gD-conjugated liposomes for receptor-specific drug delivery

    • gD-based chimeric antigen receptors for cellular therapies

Critical Considerations:

  • The native conformation requirement for gD function necessitates careful design of recombinant constructs

  • Cross-reactivity with human herpesvirus receptors must be thoroughly evaluated

  • Species-specific differences in receptor binding may limit translational applications

How can researchers address contradictions in the literature regarding PsHV-1 glycoprotein D functions?

Addressing contradictions in the literature regarding PsHV-1 glycoprotein D functions requires systematic evaluation of experimental variables and methodological differences:

Common Sources of Contradictory Results:

  • Viral strain variations:

    • Different PsHV-1 genotypes (1-4) may produce gD with functional variations

    • Laboratory-adapted strains versus clinical isolates

    • Passage history affecting viral glycoprotein expression

  • Expression system differences:

    • Recombinant versus virus-derived gD

    • Variability in post-translational modifications

    • Expression tags influencing protein function

  • Methodological variability:

    • Cell types used for functional assays

    • Receptor expression levels affecting sensitivity

    • Different readout systems (reporter genes, imaging techniques)

Resolution Strategies:

  • Direct comparative studies:

    • Obtain contradictory reagents from original laboratories

    • Test under identical conditions with appropriate controls

    • Use multiple complementary assays for each function

  • Standardization approaches:

    • Develop reference standards for key reagents

    • Establish consensus protocols for functional assays

    • Create a repository of validated constructs and cell lines

  • Systematic structure-function analysis:

    • Map functional domains using deletion/mutation libraries

    • Correlate sequence variations with functional differences

    • Use structural biology to identify critical residues

Case Study Resolution Table:

Contradictory FindingPotential ExplanationsResolution Approach
Receptor preference discrepancyDifferent domains of gD used in studiesTest full-length versus truncated gD forms
Variable immune evasion capacityCell type-specific effectsCompare multiple relevant avian and mammalian cell types
Inconsistent TAP inhibitionTAP species specificityTest against both avian and mammalian TAP complexes
Divergent entry efficiencyReceptor density variationsQuantify receptor levels and correlate with entry
Conflicting antigenic profilesConformational versus linear epitopesUse both native and denatured gD in assays

The most effective approach combines independent replication of key experiments, careful control of variables, and integration of findings through systematic reviews and meta-analyses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.