Recombinant Psittacid herpesvirus 1 Envelope glycoprotein E (US8)

Shipped with Ice Packs
In Stock

Description

Introduction to Psittacid Herpesvirus 1 and Glycoprotein E

Psittacid herpesvirus 1 (PsHV-1), also known as Pacheco's disease virus, is a significant pathogen affecting psittacine birds, particularly Amazon parrots. The virus contains multiple glycoproteins on its envelope that facilitate viral entry, cell-to-cell spread, and immune evasion. Envelope glycoprotein E (gE), encoded by the US8 gene, is one of these essential structural components that plays crucial roles in viral pathogenesis and transmission.

Glycoprotein E is a membrane-associated protein that functions in complex with glycoprotein I (gI) to form a heterodimer critical for viral spread. The protein is characterized by its extensive extracellular domain, a transmembrane region, and a cytoplasmic tail that mediates intracellular signaling and trafficking. Understanding the structure and function of gE provides valuable insights into viral mechanisms and potential targets for therapeutic intervention.

The recombinant form of this glycoprotein has been produced to facilitate research into viral mechanisms and to develop diagnostic tools. By expressing PsHV-1 gE in bacterial systems, researchers can obtain purified protein for structural analysis, functional studies, and the development of serological assays. These recombinant proteins serve as invaluable tools for advancing our understanding of viral pathogenesis.

Biological Functions of Glycoprotein E

Envelope glycoprotein E (US8) plays multiple crucial roles in viral infection and spread. The protein primarily functions as part of a heterodimer with glycoprotein I, mediating several essential viral processes. One of the most significant functions is its role in cell-to-cell viral spread, particularly in epithelial tissues.

In epithelial cells, the gE/gI heterodimer is required for the cell-to-cell spread of the virus through a mechanism involving the sorting of newly formed virions to cell junctions . This specialized targeting enables the virus to bypass extracellular spaces where it would be vulnerable to neutralizing antibodies and other immune defenses. Once the virus reaches these cellular junctions, viral particles can spread to adjacent cells with remarkable efficiency through interactions with cellular receptors that accumulate at these junctions .

The glycoprotein is also implicated in basolateral spread in polarized cells, which is critical for establishing infection in epithelial tissues. This directional spread allows the virus to penetrate deeper layers of tissue and establish more widespread infection. The ability to spread through basolateral mechanisms contributes significantly to viral pathogenesis and the establishment of persistent infections.

In neuronal cells, gE/gI plays an even more specialized role that is essential for the anterograde spread of infection throughout the host nervous system . This directional transport is critical for viral dissemination from sensory ganglia to peripheral tissues during reactivation from latency. The protein accomplishes this by facilitating the packaging and transport of viral components along axons to distal sites.

Furthermore, gE works in conjunction with another viral protein, US9, to orchestrate the sorting and transport of viral structural components toward axon tips . This collaborative function enables efficient viral assembly at distant sites and contributes to the neurotropism exhibited by herpesviruses. The coordinated action of these viral proteins overcomes the challenges of long-distance transport within neuronal cells.

Recombinant Production and Properties

Recombinant Psittacid herpesvirus 1 Envelope glycoprotein E is produced using bacterial expression systems, primarily Escherichia coli, to generate sufficient quantities of purified protein for research and diagnostic applications. The recombinant protein typically includes either a histidine tag (His-tag) or is produced in tag-free form, depending on the specific application requirements .

The production process involves cloning the US8 gene fragment (encoding amino acids 21-568) into an appropriate expression vector, transforming E. coli cells, and inducing protein expression under controlled conditions. Following expression, the protein is extracted from bacterial cells and purified using affinity chromatography, particularly for His-tagged variants. The purification process yields protein with greater than 90% purity, as determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) .

The biochemical properties of the recombinant protein include:

PropertySpecification
Expression SystemE. coli
Tag OptionsHis-tag or Tag free
Fragment21-568 amino acids
Purity>90% (SDS-PAGE)
Biological ActivityFunctional binding in ELISA
Storage-20°C (glycerol buffer)
ApplicationsELISA, Western Blot, Immunoprecipitation

The recombinant protein maintains its antigenic properties and can bind to specific antibodies, making it suitable for immunological assays. The biological activity of the protein is determined by its binding ability in functional enzyme-linked immunosorbent assay (ELISA) . This retention of functional binding indicates that the recombinant protein maintains conformational epitopes similar to those of the native viral protein.

Commercial preparations of the recombinant protein are typically available in multiple quantity options (100 μg, 500 μg, 1 mg) to accommodate different experimental needs . The protein is often supplied in a storage buffer optimized for stability, and proper storage at -20°C is recommended to maintain protein integrity and activity.

Applications in Research and Diagnostics

Recombinant Psittacid herpesvirus 1 Envelope glycoprotein E serves multiple important functions in both research and diagnostic applications. The protein is particularly valuable for developing sensitive and specific immunoassays for detecting anti-PsHV-1 antibodies in avian samples. These diagnostic tools are crucial for identifying infected birds, monitoring disease spread, and implementing effective control measures in avian populations.

The recombinant protein can be used in several laboratory techniques, including enzyme-linked immunosorbent assay (ELISA), Western blotting (WB), and immunoprecipitation (IP) . In ELISA applications, the protein is typically immobilized on a solid surface to capture specific antibodies from test samples. This method provides a rapid and sensitive approach for antibody detection and has become a standard technique in veterinary diagnostics.

In research settings, the recombinant protein serves as a valuable tool for studying virus-host interactions, particularly the mechanisms of cell-to-cell spread and neuronal transport. By examining the binding partners and structural characteristics of glycoprotein E, researchers can gain insights into fundamental viral processes and identify potential targets for antiviral interventions.

The protein's role in mediating viral spread through epithelial junctions makes it particularly interesting for studies focused on viral transmission and pathogenesis. By understanding how glycoprotein E facilitates these processes, researchers may identify novel approaches to block viral dissemination and limit disease progression. Additionally, the protein's involvement in neuronal transport provides opportunities to investigate specialized mechanisms of viral transport in the nervous system.

Immunization studies using the recombinant protein may also yield valuable information about protective immune responses and guide the development of vaccines against PsHV-1. By eliciting antibodies that target functional domains of glycoprotein E, it may be possible to block critical steps in viral infection and spread.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
US8; Envelope glycoprotein E; gE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-568
Protein Length
full length protein
Species
Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) (PsHV-1) (Pacheco's disease virus)
Target Names
US8
Target Protein Sequence
QRVDSTTIHHVSGLKGKPLLFGPSLRRTLPAGGTFKWVLVLSDPCAPKPTEICVSVGHCF YDLVSSDNDSECANKDRRVLTLALLTKSKTGELRVIGPMAASSALVGDAGELEQLRRRVS AGMGLTDDGDISFAAADKVNEGLYGVRVMGSGDSYTFFNVTVATETAGDDRDLATVRHVD IAHNIVPSEDRDHVFVSMPRMHVAWPHGTTVLHPKMIIAAASWRPEYNFTYEWYAVPYDG YCATMRLFEACLYHPSAPACLDPAGHRGCVVGTMTHDDLVGRVLMARCRGSDLRTCEPHV IHIKQKPMVSLGRAVPELRVESAAHIPSLYILVVKIDDSVAGWAYTELMAEGSSPRVVID IHMPRPTSAQGGIAALREIENDDSAPSLGSNEGGGPGNSKRRAAVLGAAVWIALTLLILG GLGAYVAVNKKCLRDKRQWLRGSRKPTLETHAHTYTSLPVGGDLSLEQDAEDEDEDEEEL LYERERRRSSSGSKKSSRSPSRRSSRRNSFGPTLSANALSRFDKTVKLAMAEVAGRLLAN KTFPSQRY
Uniprot No.

Target Background

Function

In epithelial cells, the gE/gI heterodimer is essential for cell-to-cell viral spread. It facilitates the targeting of nascent virions to cell junctions, enabling rapid spread to adjacent cells via interactions with junctional cellular receptors. This is implicated in basolateral spread in polarized cells. In neuronal cells, gE/gI is crucial for anterograde infection spread throughout the nervous system. In conjunction with US9, gE/gI participates in the sorting and axonal transport of viral structural components.

Database Links

KEGG: vg:2656958

Protein Families
Alphaherpesvirinae glycoprotein E family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein. Host cell junction. Host Golgi apparatus membrane; Single-pass membrane protein. Host endosome membrane; Single-pass membrane protein.

Q&A

What is Psittacid herpesvirus 1 Envelope glycoprotein E and what is its role in viral pathogenesis?

Psittacid herpesvirus 1 Envelope glycoprotein E (gE) is a viral glycoprotein encoded by the US8 gene that serves as a major virulence determinant in PsHV-1. While not essential for viral replication, gE plays several critical roles in viral pathogenesis:

  • Secondary envelope coating of virions, with deletion resulting in massive capsid accumulation around vesicles

  • Cell-to-cell transmission, facilitating direct spread between adjacent cells

  • Enhancement of neurovirulence through specific interactions with host neural cells

  • Immune evasion through interaction with host antibodies

The gE protein typically forms a heterodimer with glycoprotein I (gI), encoded by the US7 gene, and this complex participates in multiple functions during the viral life cycle . This heterodimer can interact with the Fc fragment of immunoglobulin G (IgG) to regulate host immune responses .

How does the structure of PsHV-1 gE compare to other alphaherpesvirus gE proteins?

PsHV-1 belongs to the alphaherpesvirus subfamily, which includes other significant pathogens like herpes simplex virus (HSV), pseudorabies virus (PRV), and infectious laryngotracheitis virus (ILTV) . Comparative analysis reveals:

  • PsHV-1 and ILTV share similar structural characteristics, with genomes of 163,025 bp and 148,665 bp, respectively

  • Unlike some other alphaherpesviruses, ILTV glycoproteins (and potentially PsHV-1 by extension) lack consensus motifs for heparin binding, suggesting a heparin-independent method for host cell attachment

  • The US8 gene sequence shows variability between strains, with single-nucleotide polymorphisms (SNPs) discovered in this region, indicating it may be a hotspot for recombination within the viral genome

  • The amino acid sequence from the ILTV US8 region contains distinct features that differentiate it from other alphaherpesviruses, potentially contributing to its restricted host range

The functional domains of PsHV-1 gE include:

  • Ectodomain: Contains regions for interactions with gI and host IgG Fc portions

  • Transmembrane domain: Anchors the protein in the viral envelope

  • Cytoplasmic tail: Contains motifs for intracellular trafficking and interactions with tegument proteins

  • IgG binding regions: Facilitate immune evasion through antibody bipolar bridging

The amino acid sequence of PsHV-1 gE includes regions that form a heterodimer with gI, creating a complex that can participate in multiple functions of the virus . This heterodimer interacts with the Fc fragment of IgG to regulate the phosphorylation of extracellular regulated protein kinases 1/2 (ERK1/2), which facilitates immune evasion after infection .

How does the gE/gI complex contribute to immune evasion in PsHV-1?

The gE/gI complex facilitates sophisticated immune evasion through several mechanisms:

  • Fc Receptor Activity (Antibody Bipolar Bridging):

    • Binds to the Fc portion of host IgG antibodies

    • Prevents antibody-mediated immune functions by blocking Fc recognition by immune effector cells

    • Inhibits complement activation

    • Creates "bipolar bridging" where antibodies simultaneously bind to viral antigens and the gE/gI complex

  • Modulation of Cell Signaling:

    • Interacts with the Fc fragment of IgG to regulate ERK1/2 phosphorylation

    • This modulation may suppress antiviral responses

  • Promotion of Cell-to-Cell Spread:

    • Facilitates direct spread between adjacent cells, shielding the virus from neutralizing antibodies

These mechanisms collectively enable PsHV-1 to evade host immune responses effectively. Research methodologies to study these mechanisms include Fc binding assays, signaling assays to measure ERK1/2 phosphorylation, and cell culture systems to assess antibody-dependent cellular cytotoxicity in the presence/absence of gE/gI.

What methodologies are effective for investigating gE's role in cell-to-cell transmission?

Several specialized methodologies can be employed to investigate PsHV-1 gE's role in cell-to-cell transmission:

  • Plaque Size Analysis:

    • Compare plaque sizes of wild-type and gE-deleted viruses

    • Smaller plaques indicate impaired cell-to-cell spread

    • Quantifiable measure of transmission efficiency

  • Live-Cell Imaging:

    • Use fluorescently tagged viruses

    • Track viral spread between cells in real-time

    • Analyze velocity and pattern of spread

  • Transmission Electron Microscopy:

    • Examine virus particle localization at cell junctions

    • Compare wild-type and gE-deleted viruses

    • Visualize morphological differences in virus assembly and exit

  • Co-Cultivation Assays:

    • Infect donor cells with wild-type or gE-deleted viruses

    • Co-culture with uninfected target cells

    • Measure virus transfer in the presence of neutralizing antibodies (which block cell-free spread)

Deletion of gE results in massive capsid accumulation around vesicles, severely inhibiting virion formation, suggesting that gE plays an important role in the secondary envelope coating of the cytoplasmic nucleocapsid .

How can gene deletion approaches be used to study PsHV-1 gE function?

Gene deletion approaches provide powerful tools for studying PsHV-1 gE function:

  • Homologous Recombination Method:

    • Design a transfer vector containing flanking sequences of the US8 gene with a selection marker

    • Co-transfect permissive cells with viral genomic DNA and the transfer vector

    • Select recombinant viruses based on marker expression

    • Confirm deletion through PCR, restriction analysis, and sequencing

  • CRISPR/Cas9 Editing:

    • Design guide RNAs targeting the US8 gene

    • Co-transfect cells with viral DNA, Cas9, and guide RNAs

    • Screen for edited viruses using PCR and sequencing

  • Expected Phenotypic Changes:

    • Impaired secondary envelopment with accumulation of capsids

    • Reduced cell-to-cell spread

    • Decreased virulence in vivo

    • Altered immune evasion capacity

The deletion of specific genes has proven effective in the development of attenuated marker vaccines for related alphaherpesviruses. For instance, in ILTV, gene-deleted recombinants targeting specific genes like ORF C, Us4 (gG), UL47, UL23, UL0, and US5 (gJ) have demonstrated varying degrees of attenuation . Similar approaches could be applied to PsHV-1 gE.

How does PsHV-1 gE interact with other viral proteins?

PsHV-1 gE interacts with several other viral proteins to perform various functions during the viral life cycle:

  • gE-gI Heterodimer Formation:

    • gE forms a heterodimer with gI (encoded by US7)

    • This complex participates in multiple functions including immune evasion and cell-to-cell spread

    • The heterodimer interacts with the Fc fragment of IgG to regulate host immune responses

  • Interactions with Tegument Proteins:

    • gE likely interacts with tegument proteins to facilitate secondary envelopment

    • In related alphaherpesviruses, interactions between glycoproteins and tegument proteins (such as gH with VP16, gK with UL37, and gD with UL16) assist in secondary envelope coating of virions

    • These interactions facilitate viral transport to cell junctions and aid in virus spread

  • gE-UL7-UL51 Complex:

    • In related alphaherpesviruses like HSV-1, gE forms functional complexes with UL7-UL51

    • These complexes localize at cell surface junctions where gE can accumulate

    • They affect the morphology of virus-infected cells and provide physical structural support for cells

Research methods to study these interactions include co-immunoprecipitation, proximity ligation assays, yeast two-hybrid screens, and fluorescence resonance energy transfer (FRET) techniques.

What are the applications of PsHV-1 gE in vaccine development?

PsHV-1 gE is an important target for vaccine development strategies:

  • DIVA Vaccine Strategy (Differentiating Infected from Vaccinated Animals):

    • gE-deleted mutants can serve as live attenuated marker vaccines

    • Allows differentiation between vaccinated and naturally infected birds

    • Similar approaches have been successful with other alphaherpesviruses

  • Subunit Vaccine Approach:

    • Recombinant gE protein can be used as a subunit vaccine component

    • May induce protective antibody responses against critical epitopes

  • Viral Vector Expression:

    • gE can be expressed in viral vectors for immunization

    • Induces both humoral and cell-mediated immune responses

  • Challenges:

    • Multiple PsHV-1 serotypes exist, and infection with one serotype does not protect against infection with another

    • A polyvalent vaccine would be necessary to prevent infection with all serotypes

    • Currently, no approved vaccine for PsHV-1 is available in Australia

The gE gene is often the target for the construction of gene-deleted attenuated marker vaccines in related herpesviruses . Similar strategies could potentially be applied to PsHV-1, although the existence of multiple serotypes presents additional challenges.

How can recombinant PsHV-1 gE be used for diagnostic assay development?

Recombinant PsHV-1 gE offers several applications for diagnostic assay development:

  • ELISA-Based Detection:

    • Recombinant gE can be used as capture antigen in ELISA assays

    • Allows detection of anti-gE antibodies in infected birds

    • The biological activity of recombinant gE can be determined by its binding ability in functional ELISA

  • PCR-Based Diagnostics:

    • Primers targeting the US8 gene can be used for specific detection of PsHV-1

    • Particularly useful for detection during early infection or in carrier birds

  • DIVA Testing:

    • If gE-deleted vaccines are implemented, ELISA tests targeting gE can differentiate between vaccinated and infected birds

    • This approach has been successfully used for other herpesviruses

  • Challenges:

    • Cross-reactivity with other avian herpesviruses must be addressed

    • Sensitivity in detecting latent infections requires optimization

    • Multiple PsHV-1 genotypes exist, necessitating broad-spectrum detection systems

Given that PsHV-1 has been reported in wild Australian birds, including both psittacine and non-psittacine species , reliable diagnostic tools are essential for monitoring and controlling potential outbreaks.

What are the challenges in detecting PsHV-1 in clinical samples?

Several challenges exist in the reliable detection of PsHV-1 in clinical samples:

  • Latent Infection Detection:

    • During latency, viral gene expression is limited and virus particles are not produced

    • Conventional detection methods may yield false negatives

    • PCR targeting latency-associated transcripts may improve detection

  • Genetic Diversity:

    • Four major genotypes of PsHV-1 have been identified

    • Diagnostic assays must account for genetic variations in the US8 gene

    • Multiple primer sets or broad-spectrum primers may be necessary

  • Carrier Status:

    • Subclinically-infected birds can be carriers

    • Intermittent viral shedding may result in sampling challenges

    • Stress-induced reactivation protocols may enhance detection

  • Sample Quality Issues:

    • Degradation of viral nucleic acids in field samples

    • Presence of inhibitors in avian samples

    • Need for optimized extraction protocols

  • Testing Strategy:

    • PCR is recommended for active infection detection

    • Serology for previous exposure assessment

    • Combined approaches for comprehensive screening

Given these challenges, a multi-faceted diagnostic approach is often necessary for reliable PsHV-1 detection.

How can structural analysis of PsHV-1 gE inform antiviral development?

Structural analysis of PsHV-1 gE can provide valuable insights for antiviral development:

  • Identification of Conserved Functional Domains:

    • Structural determination can reveal conserved domains across alphaherpesvirus gE proteins

    • These domains may serve as targets for broad-spectrum antiviral compounds

  • Targeting gE-gI Interaction Interfaces:

    • Disruption of the gE-gI heterodimer formation could impair multiple viral functions

    • Small molecule inhibitors could be designed to interfere with this interaction

  • Blocking Immune Evasion Mechanisms:

    • Compounds that prevent gE-Fc interactions could enhance immune clearance of the virus

    • This approach targets a key virulence mechanism rather than viral replication

  • Structure-Based Drug Design:

    • In silico screening against the gE structure to identify potential binding compounds

    • Rational optimization of lead compounds based on structural data

What are emerging research directions for PsHV-1 gE studies?

Several promising research directions are emerging in the field of PsHV-1 gE studies:

  • Comparative Genomics and Evolution:

    • Analysis of gE sequence diversity across PsHV-1 isolates

    • Understanding the evolution of immune evasion mechanisms

    • Identifying conserved regions as potential universal vaccine targets

  • Host Range Determinants:

    • Investigating how gE contributes to host specificity

    • Understanding why some psittacine species are more susceptible than others

    • Determining if gE polymorphisms correlate with host range

  • Virus-Host Interaction Networks:

    • Systems biology approaches to map gE interactions with host proteins

    • Identification of host dependency factors that could serve as therapeutic targets

    • CRISPR screens to identify essential host factors for gE function

  • Advanced Imaging Techniques:

    • Super-resolution microscopy to visualize gE trafficking in infected cells

    • Correlative light and electron microscopy to study gE localization during viral assembly

    • Live-cell imaging to track gE during viral entry and spread

  • Ecological and Epidemiological Studies:

    • Investigating the recently discovered presence of PsHV-1 in wild Australian birds

    • Understanding transmission dynamics between psittacine and non-psittacine species

    • Assessing risks to endangered psittacine populations

Future research should focus on better understanding the presence, host range, and prevalence of PsHV-1 in wild birds, particularly in Australia where it has recently been detected in wild populations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.