Recombinant Psittacid herpesvirus 1 Envelope glycoprotein H (UL22)

Shipped with Ice Packs
In Stock

Description

Introduction to Psittacid herpesvirus 1

Psittacid herpesvirus 1 (PsHV-1) is the causative agent of Pacheco's disease, a significant viral infection affecting psittacine birds (members of the parrot family) . This disease represents a considerable concern for bird breeders and veterinarians due to its high mortality rate and economic impact on the pet bird industry. Young birds in particular, when quarantined together under stressful conditions, are susceptible to virus shedding from infected individuals through pharyngeal secretions and feces .

The complete genome of PsHV-1 has been sequenced and characterized, revealing a linear double-stranded DNA molecule of 163,025 base pairs with a G+C content of 60.95% . The genome consists of two unique sequences, structurally organized in a manner that shares similarities with other alphaherpesviruses, particularly infectious laryngotracheitis virus (ILTV) .

Clinical Significance of PsHV-1 Infection

Clinical manifestations of PsHV-1 infection vary considerably, but commonly include lethargy, inconsistent diarrhea, and characteristic lesions and hemorrhages in the liver and spleen. Secondary complications may affect respiratory and renal systems, with mortality rates often approaching 100% in severely affected groups . The disease progression shares similarities with other herpesvirus infections, featuring the establishment of both productive infections with clear clinical signs and latent infections that may remain asymptomatic for extended periods.

Structure and Characteristics of Recombinant PsHV-1 Envelope Glycoprotein H (UL22)

The envelope glycoprotein H (UL22) of PsHV-1 represents a critical structural component of the viral envelope. In its recombinant form, this protein maintains the key structural and antigenic characteristics of the native viral protein while offering enhanced stability and purity for research and diagnostic applications.

Molecular Properties

Recombinant PsHV-1 Envelope glycoprotein H is associated with UniProt accession number Q6UDL0, derived from an isolate from an Amazon parrot (isolate 97-0001/1997) . Commercial preparations of this protein are typically supplied as purified recombinant protein in quantities of approximately 50 μg, formulated in Tris-based buffer with 50% glycerol to optimize stability during storage and handling .

Viral Entry Mechanism

In herpesviruses, the entry process follows a systematic sequence involving multiple envelope glycoproteins. Based on studies of related herpesviruses, glycoprotein H functions as part of a multi-component entry machinery that includes glycoprotein B (gB) and the gH/gL heterodimer . The process begins with the initial attachment of the virus to cellular heparan sulfate moieties, mediated primarily by glycoprotein C (gC). This interaction, while enhancing infection, is not essential for viral entry .

Following attachment, the viral envelope fuses with the host cell membrane through a mechanism requiring the coordinated action of glycoprotein D (gD), glycoprotein B (gB), and the glycoprotein H/glycoprotein L (gH/gL) heterodimer . This fusion event enables the viral nucleocapsid and tegument proteins to enter the host cell cytoplasm, from where they are transported to the nucleus for viral replication.

Role in Membrane Fusion

The gH/gL complex plays a crucial role in the membrane fusion process that is essential for viral entry and cell-to-cell spread. While the exact mechanism remains under investigation for PsHV-1 specifically, studies on other alphaherpesviruses suggest that gH undergoes conformational changes during fusion that are critical for activating the fusogenic potential of gB .

Interestingly, research on related herpesviruses indicates that certain mutations in gB can compensate for defects in gH, suggesting a functional interaction between these proteins during the fusion process . This compensation mechanism demonstrates the complex interplay between viral glycoproteins during infection and highlights potential targets for antiviral interventions.

Diagnostic Applications

Recombinant PsHV-1 Envelope glycoprotein H has significant potential for diagnostic applications, particularly in ELISA-based serological tests. Commercial preparations of this protein are available for research purposes, with prices ranging from approximately $2,144.00 to $5,615.00 depending on the supplier and quantity .

The recombinant protein can serve as an antigen for detecting antibodies against PsHV-1 in serological assays, similar to approaches used for other herpesviruses. For example, in studies of Chelonid herpesvirus 5, recombinant viral glycoproteins have been successfully used as antigens for seroprevalence studies and antibody production .

Research Applications

Beyond diagnostics, the recombinant glycoprotein H has valuable applications in fundamental virology research. These include:

  1. Studying virus-host interactions and entry mechanisms

  2. Investigating the structural and functional relationships of herpesvirus glycoproteins

  3. Developing and testing potential antiviral agents targeting viral entry

  4. Producing specific antibodies for immunohistochemical analyses of infected tissues

Table 1: Commercial Properties of Recombinant PsHV-1 Envelope Glycoprotein H

PropertySpecification
Product TypeRecombinant Protein
SpeciesPsittacid herpesvirus 1 (isolate Amazon parrot/97-0001/1997)
UniProt AccessionQ6UDL0
Standard Quantity50 μg
Storage BufferTris-based buffer with 50% glycerol
Price Range$2,144.00 - $5,615.00
Primary ApplicationsELISA, antibody production, research

Functional Comparison with Other Herpesvirus Glycoproteins

The function of glycoprotein H in PsHV-1 likely parallels its role in other herpesviruses, where it forms part of the core fusion machinery along with gB and gL. Studies on pseudorabies virus (PrV) have demonstrated that while the N-terminal domain of gH contains the gL-binding site and is typically essential for function, certain compensatory mutations in gB can restore function even when this domain is compromised .

Vaccine Development

The recombinant glycoprotein H presents a potential target for vaccine development against Pacheco's disease. While current vaccines primarily use inactivated whole virus preparations, subunit vaccines based on recombinant viral glycoproteins could offer advantages in terms of safety and specificity. Development of such vaccines remains an active area of research with significant potential impact on avian health.

Diagnostic Improvement

Current diagnostic methods for PsHV-1 infection include PCR for viral DNA detection and histopathological examination of affected tissues. The availability of recombinant viral glycoproteins like gH enables the development of more specific serological tests that could detect both active and past infections. These improved diagnostics would enhance surveillance capabilities and contribute to more effective disease management strategies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will strive to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form maintains stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
gH; UL22; Envelope glycoprotein H; gH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
41-806
Protein Length
full length protein
Species
Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) (PsHV-1) (Pacheco's disease virus)
Target Names
gH
Target Protein Sequence
TKDIVTMHATRNSLIPKDTLTVAVVMIDSYDNRLVFHANKNLLFGASNTSARALAEAYNL LGEVYVTYAYYRWARDDRPVAVGRPAPDYVLGTRLLSGPGSQKIKPPEERPSFPLSGSLR GKSLLMPRKVIFNDPLQTLMPFVFTRYLSITLSGYWDISVNSGKNVFSLCVSSPATPPVE VIATPRSAKLRESRFPQWPRYLYVSSSETSVLVNVAAGTSYKPRLYNATLAGVKAFLEVQ NYGSHVAAGQLLTIKQLLKHGCNREPDEPFVVAAALHFGAAWHRFAALAAETYVTDAEIL EFVVTTETWAKQVELCFSANAPQLGAAPPASRLAILSGRGGADEGLINVPYAILQVSRER YWGEVRSVNEQLTILTAILGSVDRLGAAAYLPSADGVAPHAFAASIIDSYYHKLIRGSAT DKIDRKTLSAAVRVFLARKADSIPTARRVLTHMTVLCSEHQAQNPLVDITGTIDAASGHG EIFCLDDLFTPCAAALRFDLEPQANRPSGNVISASAVYRTLYGSFLYGGSELETAALLDD SARVIAAAQPVGGPKAYADMFFPELARCFDWTRENSIVFYIAISDSASWILTTRPVTGGV RYRLPDTSIRTNLYLTYFNASCSKEPFASRVEKITSGYVNLHGASIACKLCGHALLRYSL GGFEDVFVIRTADEERQMTMGANSSIQYFRAMDPTYFNYILMDSSGSALRVLAFTHGSYA VDKNYIIGIAVGSLAGVFAVAFAARSIYKFYRGRANRYTLLTNDYD
Uniprot No.

Target Background

Function
The heterodimer glycoprotein H-glycoprotein L is essential for the fusion of viral and plasma membranes, enabling virus entry into the host cell. Following initial binding to the host receptor, membrane fusion is orchestrated by the fusion machinery consisting of gB and the heterodimer gH/gL. This protein may also play a role in the fusion between the virion envelope and the outer nuclear membrane during virion morphogenesis.
Database Links

KEGG: vg:2656961

Protein Families
Herpesviridae glycoprotein H family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein. Host endosome membrane; Single-pass type I membrane protein.

Q&A

What is the genomic structure of PsHV-1 and where is the UL22 gene located?

The PsHV-1 genome consists of 163,025 base pairs containing 73 predicted open reading frames (ORFs) . The genome exhibits structural characteristics similar to other alphaherpesviruses, including an inversion in the unique long region that resembles the arrangement found in pseudorabies virus . The UL22 gene is located within the unique long (UL) region of the genome and encodes glycoprotein H, which is highly conserved across herpesviruses. Based on sequence analysis and structural organization, PsHV-1 has been assigned to the Iltovirus genus alongside infectious laryngotracheitis virus (ILTV) .

How are PsHV-1 isolates classified genotypically and serotypically?

PsHV-1 isolates can be classified using multiple molecular techniques:

RFLP Analysis: Restriction Fragment Length Polymorphism with the PstI enzyme has revealed distinct restriction patterns, including A1, X, W, and Y profiles . The A1 pattern corresponds to the predominant PsHV-1 genotype.

PCR Amplification Patterns: Using six pairs of primers, researchers have identified multiple variants of PsHV-1, with variants 10, 8, and 9 being most prevalent in Brazilian isolates .

Serological Classification: Serologically, PsHV has been classified into five serotypes based on cross-neutralization testing. Genotype 1 correlates directly with serotype 1, genotype 2 with serotype 2, and genotype 3 with serotype 3. Genotype 4 has been correlated with both serotypes 1 and 4 .

Classification MethodPatterns/Types IdentifiedMost Common in ResearchNotes
RFLP (PstI)A1, X, W, YA1Only A1 was previously described in literature
PCR AmplificationVariants 1-10Variants 10, 8, 9Six variants identified in Brazilian isolates
SerotypingSerotypes 1-5Serotypes 1-3Direct correlation between genotypes and serotypes

What is the conserved function of glycoprotein H in herpesviruses?

Glycoprotein H (gH), encoded by the UL22 gene, is highly conserved across the herpesvirus family and plays critical roles in viral entry . In conjunction with glycoprotein L (gL, encoded by UL1), gH forms a functional complex that is essential for the membrane fusion process during viral entry . This complex participates in the herpesvirus fusion machinery alongside glycoprotein B (gB) .

The primary functions of the gH/gL complex include:

  • Transmission of fusogenic signals following receptor binding

  • Activation of the membrane fusion machinery

  • Facilitation of viral envelope and host cell membrane merging

  • Contribution to viral tropism and host range determination

The structural and functional conservation of gH across herpesviruses suggests that methodologies developed for studying gH in other viral systems can be adapted for PsHV-1 research .

How does glycoprotein H contribute to the membrane fusion mechanism?

Glycoprotein H functions as part of a sophisticated molecular machinery at the herpesvirus surface. Based on recent structural analyses, gH participates in a cascade of conformational changes that enables viral entry . When glycoprotein D (gD) binds to cellular receptors, it triggers a fusogenic signal that is transmitted to the gH/gL complex . This signal activates gB, the primary fusion protein, leading to the merging of viral and cellular membranes .

The specific contribution of gH in this process involves:

  • Signal transduction from receptor-binding proteins to fusion executors

  • Stabilization of pre-fusion conformations

  • Coordination with gL to expose fusion domains

  • Possible direct interaction with cellular membranes during the fusion process

Understanding these mechanisms requires sophisticated experimental approaches, including structural analysis, mutational studies, and real-time imaging of the fusion process .

What are the recommended protocols for cloning and expressing recombinant PsHV-1 UL22?

Based on methodologies successfully applied to related herpesviruses, the following approach is recommended for cloning and expressing recombinant PsHV-1 glycoprotein H:

PCR Amplification of UL22 Gene:

  • Design primers with appropriate restriction sites (commonly EcoRI and XhoI or KpnI) based on the published PsHV-1 sequence .

  • Optimize PCR conditions: pre-denaturation at 98°C for a minimum of 2 minutes, followed by 30 cycles of denaturation (98°C, 10s), annealing (55°C, 30s), and extension (72°C, 30s) .

  • Verify amplified products through gel electrophoresis and sequence analysis.

Plasmid Construction:

  • Digest both the PCR product and expression vector (e.g., pET-32a(+) for bacterial expression or pCMV-Myc for mammalian expression) with appropriate restriction enzymes .

  • Ligate the digested PCR product and vector using T4 DNA ligase.

  • Transform the recombinant plasmid into competent cells and select transformants.

  • Verify the recombinant plasmid by restriction enzyme digestion and sequencing.

Protein Expression:

  • For bacterial expression: Transform plasmid into E. coli Rosetta strain and optimize induction conditions (IPTG concentration and induction time) .

  • For mammalian expression: Transfect cells (e.g., COS-7) using lipofection reagents with optimized DNA:reagent ratios .

  • Confirm protein expression through Western blotting or immunofluorescence assays.

How can researchers effectively study interactions between glycoprotein H and other viral proteins?

Several complementary techniques have proven effective for studying interactions between herpesvirus glycoproteins:

Co-immunoprecipitation (Co-IP):
This technique has successfully demonstrated protein-protein interactions in related herpesviruses, such as the interaction between UL21 and UL16 in Bovine herpesvirus 1 . For studying PsHV-1 gH interactions:

  • Express tagged versions of gH (e.g., Myc-tagged) and potential interaction partners (e.g., Flag-tagged gL) in mammalian cells .

  • Lyse cells under non-denaturing conditions to preserve protein complexes.

  • Perform immunoprecipitation using antibodies against one tag (e.g., anti-Myc).

  • Analyze precipitated complexes by SDS-PAGE and Western blotting with antibodies against the other tag (e.g., anti-Flag).

Co-localization by Immunofluorescence:

  • Express fluorescently tagged proteins (e.g., pEGFP-N-gH and pDsRED-N-gL) in mammalian cells .

  • Fix cells at appropriate timepoints after transfection.

  • Visualize protein localization using confocal microscopy.

  • Analyze co-localization patterns using image analysis software.

Bimolecular Fluorescence Complementation (BiFC):
This advanced technique allows direct visualization of protein interactions in living cells and can be applied to study gH interactions with other viral glycoproteins.

What approaches should be used to analyze variation in UL22 sequences across different PsHV-1 isolates?

Analyzing variation in UL22 sequences requires a multi-faceted approach:

Sequence-Based Analysis:

  • PCR amplification of the UL22 gene from clinical isolates using conserved primers.

  • DNA sequencing of amplified products.

  • Multiple sequence alignment to identify variable regions.

  • Calculation of nucleotide and amino acid diversity indices.

  • Identification of selection pressures using dN/dS ratios.

RFLP Analysis:
RFLP has proven valuable for genotyping PsHV-1 isolates . For UL22-specific analysis:

  • Identify restriction enzymes with multiple recognition sites in the UL22 gene.

  • Digest amplified UL22 fragments with selected enzymes.

  • Analyze restriction patterns by gel electrophoresis.

  • Compare patterns across isolates to identify distinct profiles.

Phylogenetic Analysis:

  • Construct phylogenetic trees based on UL22 sequences.

  • Compare UL22 phylogeny with whole-genome phylogeny to identify potential recombination events.

  • Analyze the relationship between UL22 sequence clusters and viral phenotypes.

A comparative analysis of 36 Brazilian PsHV-1 isolates demonstrated the utility of combining RFLP and PCR-based approaches for comprehensive genotyping, although these studies focused on the UL16 gene rather than UL22 .

How can researchers correlate UL22 genetic variations with phenotypic differences?

Establishing correlations between UL22 genetic variations and phenotypic differences requires systematic experimental approaches:

Site-Directed Mutagenesis:

  • Identify naturally occurring variations in the UL22 gene across isolates.

  • Introduce specific mutations into a reference UL22 sequence.

  • Express wildtype and mutant gH proteins in cell culture systems.

  • Compare functional properties, including fusion activity, protein stability, and interaction with partner proteins.

Recombinant Virus Construction:

  • Generate recombinant viruses carrying specific UL22 variants.

  • Assess viral growth kinetics, plaque morphology, and cell-to-cell spread.

  • Evaluate pathogenicity in appropriate animal models.

Structure-Function Analysis:

  • Map variations to predicted structural domains of gH.

  • Focus on variations in domains likely to participate in fusion or interaction with other glycoproteins.

  • Perform targeted functional assays based on the predicted impact of specific variations.

What are common obstacles in expressing functional recombinant glycoprotein H and how can they be addressed?

Glycoprotein expression often presents specific challenges that require methodological adjustments:

Protein Misfolding and Inclusion Body Formation:

  • Optimize expression conditions: lower temperature (16-20°C), reduced inducer concentration, and slower induction.

  • Express protein as fusion with solubility-enhancing tags (e.g., MBP, SUMO).

  • If bacterial expression proves problematic, transition to eukaryotic expression systems.

Post-Translational Modifications:

  • Membrane glycoproteins typically require proper glycosylation for function.

  • Express in mammalian cell lines (e.g., COS-7, HEK293) for authentic glycosylation patterns .

  • Consider insect cell expression systems (baculovirus) as an alternative.

Protein Instability:

  • Optimize buffer conditions during purification.

  • Include appropriate protease inhibitors in all buffers.

  • Consider co-expression with binding partners (e.g., gL) to stabilize the protein complex.

How can researchers distinguish between structural and functional roles of glycoprotein H?

Distinguishing between structural and functional roles requires specialized experimental approaches:

Domain-Swapping Experiments:

  • Generate chimeric proteins containing domains from PsHV-1 gH and other herpesvirus gH proteins.

  • Assess the ability of chimeric proteins to complement gH-null mutants.

  • Evaluate specific functions (membrane fusion, protein interactions) of chimeric constructs.

Functional Complementation Assays:

  • Develop cell-based fusion assays to quantify gH fusogenic activity.

  • Establish systems to assess gH-gL complex formation efficiency.

  • Monitor trafficking of wildtype and mutant gH to appropriate cellular compartments.

What are promising approaches for developing vaccines or antivirals targeting PsHV-1 glycoprotein H?

The critical role of glycoprotein H in viral entry makes it an attractive target for intervention strategies:

Subunit Vaccine Development:

  • Express and purify recombinant gH or gH/gL complex.

  • Evaluate immunogenicity in appropriate animal models.

  • Assess neutralizing antibody production and protective efficacy.

  • Consider combining gH with other immunogenic viral proteins.

Monoclonal Antibody Development:

  • Immunize mice with purified recombinant gH/gL complex.

  • Generate hybridomas and screen for antibodies that neutralize viral infection.

  • Characterize epitopes recognized by neutralizing antibodies.

  • Evaluate therapeutic potential in animal models.

Small Molecule Inhibitor Screening:

  • Develop high-throughput assays for gH function or gH-gL interaction.

  • Screen chemical libraries for compounds that inhibit gH function.

  • Optimize lead compounds for specificity and potency.

  • Evaluate efficacy in cell culture and animal models.

How might advances in structural biology contribute to understanding PsHV-1 glycoprotein H function?

Recent advances in structural biology offer unprecedented opportunities for understanding glycoprotein H function:

Cryo-Electron Microscopy (Cryo-EM):

  • Determine the structure of the gH/gL complex alone and in association with other glycoproteins.

  • Visualize conformational changes during the fusion process.

  • Identify potential sites for therapeutic intervention.

Integrative Structural Biology:

  • Combine multiple structural techniques (X-ray crystallography, NMR, SAXS) to build comprehensive models.

  • Integrate structural data with functional assays to establish structure-function relationships.

  • Utilize molecular dynamics simulations to explore conformational dynamics.

Structure-Based Drug Design:

  • Identify druggable pockets in the gH structure.

  • Design compounds that specifically target functional domains.

  • Iterate between structure determination and compound optimization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.