Recombinant Psittacid herpesvirus 1 Envelope glycoprotein I (US7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If a specific tag is required, please inform us for preferential development.
Synonyms
gI; US7; Envelope glycoprotein I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-408
Protein Length
Full Length of Mature Protein
Species
Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) (PsHV-1) (Pacheco's disease virus)
Target Names
gI
Target Protein Sequence
TVIKGLGVSGVFEDTLVVFEKVETEDVGARLVFLGDQRPKNPYGGTVRVLFQPGESGTCS IPLLQVRYSNCTNTSAAVFSGCYRTDTEFSVPRANRGTSPGFVSLRTPTMLDSGDIYVTV HLDHLPRPDAFRIKFVSLYTGNETVRISTKDRAGRDRDSYGGASSPVGGRDSNRRTASRN DDGDLPLALYGPCRPCGKNCKNLREYLLTEESWHEWTSVFAPTTVAPTTTVATTAMRSTT VSFATMTAEVITSTGTVSMEPHNTTTADMVNLTAADPPPSEPVPALNALAIGLVVGGTVA SLVFLSVILGGLISCCARRRSARRLLTRSNSAREMEDLAPSSEDARTSRMSPDVVELSEL VNGAPLSHRNDIGGDDLTSISSASG
Uniprot No.

Target Background

Function

In epithelial cells, the gE/gI heterodimer is essential for cell-to-cell viral spread. It facilitates the targeting of nascent virions to cell junctions, enabling rapid spread to adjacent cells via interactions with junctional cellular receptors. This process is implicated in basolateral spread in polarized cells. In neuronal cells, gE/gI is crucial for anterograde infection spread throughout the nervous system. In conjunction with US9, gE/gI participates in the sorting and axonal transport of viral structural components.

Database Links

KEGG: vg:2656995

Protein Families
Alphaherpesvirinae glycoprotein I family
Subcellular Location
Virion membrane; Single-pass membrane protein. Host cell membrane; Single-pass type I membrane protein. Host cell junction. Host Golgi apparatus membrane; Single-pass type I membrane protein.

Q&A

What is Psittacid herpesvirus 1 (PsHV-1) and what is its significance in avian pathology?

PsHV-1 is the causative agent of Pacheco's disease, an acute, highly contagious, and potentially lethal respiratory herpesvirus infection in psittacine birds . The virus belongs to the Alphaherpesvirinae subfamily and is proposed to be classified within the Iltovirus genus based on genomic sequence analysis . PsHV-1 has significant veterinary importance as it affects various species of captive parrots, causing substantial morbidity and mortality. Notably, PsHV DNA has been detected in 100% of mucosal papillomas from neotropical parrots, indicating its direct role in lesion development . The complete genome sequence of PsHV-1 has been determined to be 163,025 bp in length, containing 73 predicted open reading frames (ORFs) .

What methodologies are available for expressing Recombinant PsHV-1 Envelope glycoprotein I?

Recombinant PsHV-1 Envelope glycoprotein I (gI) is typically expressed in E. coli expression systems. The protein can be produced with either a His-tag or in tag-free form depending on research requirements . The standard expression involves:

  • Cloning the US7 gene fragment (encoding amino acids 24-408) into a suitable expression vector

  • Transformation into E. coli expression strains

  • Induction of protein expression

  • Purification using affinity chromatography (for His-tagged proteins) or alternative purification strategies for tag-free variants

  • Confirmation of purity (>90%) by SDS-PAGE analysis

The biological activity of the recombinant protein is typically determined by its binding ability in functional ELISA assays .

What are the standard applications of Recombinant PsHV-1 Envelope glycoprotein I in laboratory research?

Standard applications include:

ApplicationDescriptionTechnical Considerations
ELISAFor detection of antibodies against PsHV-1 in avian serum samplesOptimal coating concentration: 1-10 μg/ml
Western Blotting (WB)For detection and characterization of viral proteins and their interactionsUse under reducing or non-reducing conditions depending on epitope structure
Immunoprecipitation (IP)To study protein-protein interactions involving gICan be used to investigate gI-gE complex formation
Diagnostic TestingDevelopment of serological assays for Pacheco's diseaseUseful in multiplex assays along with other avian pathogens
Vaccine DevelopmentAs a potential antigen for subunit vaccinesRequires appropriate adjuvants and delivery systems

The recombinant protein has been validated for these applications with demonstrated binding ability in functional assays .

How does the heterodimeric complex of gE/gI contribute to cell-to-cell spread of PsHV-1?

The gE/gI heterodimeric complex plays a crucial role in the cell-to-cell spread of PsHV-1, similar to other alphaherpesviruses. Mechanistically:

  • In epithelial cells, gE/gI sorts nascent virions to cell junctions, facilitating rapid viral spread to adjacent cells through interactions with cellular receptors that accumulate at these junctions .

  • The complex mediates the translocation of progeny viruses to intercellular junctions, allowing virions to bypass the extracellular environment and evade neutralizing antibodies .

  • In polarized cells, gE/gI is specifically implicated in basolateral spread of the virus .

Research approaches to study this process include:

  • Generating US7 knockout viruses and assessing their ability to form plaques (smaller plaques indicate impaired cell-to-cell spread)

  • Syncytium formation assays to evaluate membrane fusion events

  • CRISPR/Cas9 techniques to create precise gene modifications

Studies have demonstrated that US7 knockout results in significant inhibition of viral cell-to-cell spread, with plaque sizes being significantly smaller compared to wild-type virus (p < 0.001) .

What is the significance of N-glycosylation for PsHV-1 Envelope glycoprotein I function?

N-glycosylation of viral envelope glycoproteins, including gI, is a critical post-translational modification that affects multiple aspects of virus biology:

  • Viral replication: N-glycosylation impacts viral replication efficiency through proper protein folding and trafficking.

  • Virulence: Studies with other herpesviruses have shown that N-glycosylation of gI is essential for virulence in vivo. Research has demonstrated that mutations in N-glycosylation sites can significantly reduce viral pathogenesis .

  • Structural integrity: N-glycosylation affects protein stability and conformation, which is critical for maintaining functional interactions with partner proteins (like gE).

The extracellular domain of gI contains predicted N-glycosylation consensus sequences (N-X-S/T, where X is any amino acid except proline) . Comparative analysis with other alphaherpesviruses shows that while all species have multiple predicted N-glycosylation sites, these sites are not conserved across species, suggesting adaptive evolution of glycosylation patterns .

Methodological approaches to study N-glycosylation:

  • Site-directed mutagenesis of N-glycosylation sites

  • Treatment with glycosidases (PNGaseF) to remove N-linked glycans

  • Mass spectrometry to map glycosylation sites

  • Western blot analysis to detect mobility shifts following deglycosylation

What techniques can be employed to study the interaction between PsHV-1 Envelope glycoprotein I and host cell receptors?

Several advanced techniques can be employed to study gI-receptor interactions:

TechniqueApplicationAdvantagesConsiderations
Surface Plasmon Resonance (SPR)Measure binding kinetics and affinityReal-time, label-free detectionRequires purified receptor proteins
Co-immunoprecipitationIdentify interacting partnersWorks with endogenous proteinsMay detect indirect interactions
FRET/BRETStudy interactions in living cellsReal-time monitoring in cellular contextRequires fluorescent/bioluminescent tagging
Proximity Ligation AssayVisualize interactions in situSingle-molecule sensitivityLimited to fixed samples
Cryo-electron MicroscopyDetermine 3D structure of complexesHigh resolution structural dataTechnically demanding
Super-resolution MicroscopyTrack dynamic interactions on virionsCan visualize redistribution upon cell bindingAs demonstrated with other herpesviruses

Super-resolution microscopy studies with other herpesviruses have revealed that envelope glycoproteins undergo reorganization upon cell attachment, which is crucial for initiating the cascade of events leading to membrane fusion . This approach could be adapted to study PsHV-1 gI distribution and dynamics.

How can multiplex detection systems be optimized for PsHV-1 identification in clinical samples?

Multiplex real-time PCR (rtPCR) assays can be developed to simultaneously detect PsHV-1 along with other significant avian pathogens. Research has demonstrated the effectiveness of a triplex rtPCR assay for detecting Aves polyomavirus 1, psittacine beak and feather disease virus, and psittacid herpesvirus 1 .

Optimization strategies include:

  • Target selection: For PsHV-1, the UL16 gene (encoding tegument protein) has been identified as an optimal target for PCR-based detection .

  • Primer and probe design: Using conserved regions specific to each virus to ensure broad coverage across variants while maintaining specificity.

  • Analytical validation:

    • Sensitivity: Optimized assays can detect <6 copies of viral DNA per reaction

    • Specificity: 100% analytical specificity with no cross-reactivity against other pathogens

    • Controls: Including appropriate internal controls to verify extraction efficiency

  • Clinical validation: Using archived formalin-fixed, paraffin-embedded tissues from confirmed positive and negative cases.

Performance metrics from a validated triplex assay:

What are the structural similarities and differences between PsHV-1 Envelope glycoprotein I and other herpesvirus envelope glycoproteins?

Comparative analysis of PsHV-1 gI with envelope glycoproteins from other herpesviruses reveals both conserved features and important differences:

  • Conserved structural organization:

    • Type I transmembrane protein architecture (extracellular domain, transmembrane domain, cytoplasmic domain)

    • Function in forming complexes with gE for cell-to-cell spread

    • Role in immune evasion

  • Differences in primary sequence:

    • Limited sequence conservation across herpesvirus subfamilies

    • Variability in number and position of N-glycosylation sites

    • Species-specific adaptations in the extracellular domain

  • Functional specialization:

    • In HSV-1, gI utilizes endoplasmic reticulum (ER)-associated degradation components Derlin-1 and Sec61 to facilitate ubiquitination of Toll-like receptors 3 and 4, assisting in immune evasion

    • PsHV-1 gI may have avian-specific functions related to its host cell tropism

  • Evolutionary relationships:

    • PsHV-1 is most closely related to infectious laryngotracheitis virus (ILTV), suggesting common evolutionary origins and functional similarities in their envelope glycoproteins

Research approaches to study structural relationships include:

  • Comparative sequence analysis

  • Homology modeling

  • X-ray crystallography or cryo-EM of recombinant proteins

  • Functional complementation studies across different herpesvirus species

How do genotypic variations in the US7 gene affect virulence and pathogenesis across different PsHV-1 strains?

Studies have identified significant variations in the US7 gene across different PsHV-1 strains, with consequent effects on viral pathogenicity:

  • Strain-specific functional differences:

    • Research comparing different strains (such as HB94 and HN19) has shown that US7 from different sources can have variable effects on viral cell-to-cell spread

    • US7 from some strains promotes plaque formation more effectively than US7 from other strains, indicating functional differences in the encoded glycoprotein

  • Expression level variations:

    • Significant differences in US7 gene expression levels have been observed between strains, which correlates with differences in cell-to-cell spread efficiency

  • Genotype prevalence in disease states:

    • Of the four PsHV-1 genotypes, types 1, 2, and 3 have been found in mucosal papillomas, while genotype 4 appears absent from these lesions

    • This distribution suggests genotype-specific differences in tissue tropism and pathogenicity

Research methodologies to study these variations include:

  • Genetic knockouts and complementation studies

  • Gene replacement experiments (replacing US7 from one strain with that from another)

  • Quantitative RT-PCR to measure expression levels

  • Plaque assays and syncytium formation assays to assess functional differences

  • In vivo infection studies in suitable avian models

Experimental data has shown that US7 knockout results in significantly smaller plaques compared to wild-type virus (p < 0.001), and that complementation with US7 from different strains results in variable restoration of plaque size .

What are the most sensitive detection methods for PsHV-1 in clinical and research settings?

Multiple detection methodologies have been developed for PsHV-1, each with specific advantages:

MethodSensitivitySpecificityApplicationLimitations
Triplex real-time PCR<6 copies/reaction100%Rapid detection, subclinical infectionsRequires specialized equipment
HistopathologyModerateHighDisease confirmationCannot detect subclinical infection
ImmunohistochemistryModerateHighLocalization in tissuesAntibody availability limited
ELISA using recombinant gIVariableHighSerological screeningCannot distinguish active vs past infection
Virus isolationLowVery highGold standard confirmationTime-consuming, low sensitivity

Research has demonstrated that molecular methods significantly outperform traditional histopathology for detection. In one study, birds that tested positive only by rtPCR had significantly higher cycle threshold values compared to those with histologic evidence of infection, indicating the ability to detect lower viral loads .

For optimal diagnostic sensitivity, a combination approach is recommended:

  • Initial screening with triplex rtPCR targeting the UL16 gene

  • Confirmation with histopathology in positive cases

  • Serological testing using recombinant envelope glycoproteins for population screening

How can Recombinant PsHV-1 Envelope glycoprotein I be utilized in vaccine development strategies?

Recombinant PsHV-1 Envelope glycoprotein I offers several advantages for vaccine development:

  • Subunit vaccine approach:

    • Recombinant gI can be used as a protein antigen in subunit vaccines

    • Can be combined with appropriate adjuvants to enhance immunogenicity

    • Advantage of safety compared to attenuated live vaccines

  • DNA vaccine strategies:

    • The US7 gene can be incorporated into DNA vaccine vectors

    • Expression in host cells leads to proper folding and post-translational modifications

    • Potential for inducing both humoral and cell-mediated immunity

  • Virus-like particle (VLP) incorporation:

    • Recombinant gI can be incorporated into VLPs for enhanced immunogenicity

    • Mimics natural virus structure without infectious potential

  • Prime-boost strategies:

    • DNA vaccine priming followed by recombinant protein boosting

    • Optimizes both cellular and humoral immune responses

  • Immune correlates assessment:

    • Recombinant gI can be used in assays to measure vaccine-induced antibody responses

    • Neutralization assays to evaluate functional antibody responses

Research considerations include:

  • Importance of maintaining proper conformation of neutralizing epitopes

  • Need to address potential strain variations in the US7 gene

  • Requirement for veterinary-specific adjuvant formulations

  • Balance between immunogenicity and safety in avian species

What are the optimal conditions for expressing and purifying Recombinant PsHV-1 Envelope glycoprotein I?

Optimized protocols for expression and purification include:

ParameterRecommended ConditionsNotes
Expression SystemE. coli (BL21 or Rosetta strains)For basic research applications
VectorpET series with T7 promoterAllows IPTG induction
TagHis-tag (N-terminal) or Tag-freeHis-tag facilitates purification
Induction0.5-1.0 mM IPTG, 18°C, 16-20 hoursSlower induction at lower temperature improves folding
Lysis BufferTris-based buffer with protease inhibitorsTypically pH 8.0
PurificationNi-NTA affinity chromatography (for His-tagged)Step gradient elution with imidazole
Secondary PurificationSize exclusion chromatographyRemoves aggregates and contaminating proteins
Quality ControlSDS-PAGE, Western blot, functional ELISA>90% purity is standard
StorageTris/PBS-based buffer, pH 8.0, with 50% glycerolFor long-term storage at -20°C/-80°C

For applications requiring properly folded protein with intact epitopes, consider:

  • Mammalian or insect cell expression systems to ensure proper glycosylation

  • Use of chaperon co-expression to improve folding

  • Addition of stabilizing agents (trehalose, sucrose) to prevent aggregation

Recombinant protein should be aliquoted to avoid repeated freeze-thaw cycles, which can compromise structural integrity and biological activity .

What experimental designs are most suitable for investigating PsHV-1 Envelope glycoprotein I functions in vitro?

Several experimental approaches can effectively investigate gI functions:

  • Cell-to-cell spread assays:

    • Plaque size measurement following infection with wild-type vs. US7 knockout viruses

    • Syncytium formation assays to assess membrane fusion events

    • Co-culture systems with fluorescently labeled cells to track viral transmission

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify gI-interacting partners

    • Yeast two-hybrid or mammalian two-hybrid screening

    • Pull-down assays with recombinant gI as bait

  • Membrane topology and trafficking studies:

    • Immunofluorescence microscopy to track gI localization

    • Pulse-chase experiments to follow gI trafficking through cellular compartments

    • Domain-specific antibodies to probe accessibility of different regions

  • Functional complementation:

    • Expression of gI in US7 knockout backgrounds

    • Cross-species complementation with gI from different herpesvirus strains

    • Structure-function analysis using chimeric and truncated gI constructs

  • Immune evasion assessment:

    • Reporter assays for TLR signaling in the presence/absence of gI

    • MHC-I surface expression analysis

    • NK cell activation assays

When designing these experiments, consider:

  • Use of appropriate cell lines (avian origin when possible)

  • Inclusion of proper positive and negative controls

  • Quantitative readouts for statistical analysis

  • Validation with multiple experimental approaches

How can neutralizing antibodies against PsHV-1 Envelope glycoprotein I be evaluated for efficacy?

Evaluation of neutralizing antibodies requires multiple complementary approaches:

  • In vitro neutralization assays:

    • Standard plaque reduction neutralization test (PRNT)

    • Focus reduction assays using immunostaining

    • Reporter virus assays with luminescent or fluorescent readouts

    • Cell-to-cell spread inhibition assays to specifically assess gI-targeted antibodies

  • Binding assays:

    • ELISA using recombinant gI to measure antibody titers

    • Surface plasmon resonance to determine binding kinetics and affinity

    • Competition assays to map epitope specificity

  • Functional inhibition assays:

    • Antibody inhibition of gI-gE complex formation

    • Blocking of gI-mediated immune evasion functions

    • Prevention of gI trafficking to cell junctions

  • Correlation with in vivo protection:

    • Passive transfer studies in appropriate avian models

    • Challenge studies following immunization with recombinant gI

    • Comparison of antibody responses between protected and unprotected animals

Control considerations:

  • Include both polyclonal and monoclonal antibodies with known properties

  • Test antibodies against multiple PsHV-1 strains to assess cross-reactivity

  • Establish correlations between binding titers and neutralizing activity

When interpreting results, note that antibodies targeting gI alone may not completely neutralize the virus but could significantly inhibit cell-to-cell spread, which is a critical aspect of viral pathogenesis.

What bioinformatic approaches can identify conserved functional domains in PsHV-1 Envelope glycoprotein I?

Comprehensive bioinformatic analysis can reveal important functional domains and features:

  • Sequence analysis:

    • Multiple sequence alignment of gI across PsHV-1 strains and other herpesviruses

    • Identification of conserved motifs using MEME, GLAM2, or similar tools

    • Calculation of selection pressure (dN/dS ratios) to identify evolving regions

  • Structural prediction:

    • Secondary structure prediction (PSIPRED, JPred)

    • Transmembrane domain prediction (TMHMM, Phobius)

    • 3D structure modeling using homology modeling (SWISS-MODEL, I-TASSER)

    • Molecular dynamics simulations to predict flexibility and interaction surfaces

  • Functional site prediction:

    • Post-translational modification sites (NetNGlyc for N-glycosylation)

    • Protein-protein interaction interfaces (PIER, ProMate)

    • Immunogenic epitope prediction (BepiPred, Ellipro)

    • Signal peptide and sorting motifs (SignalP, TargetP)

  • Evolutionary analysis:

    • Phylogenetic tree construction to trace evolutionary relationships

    • Ancestral sequence reconstruction

    • Coevolution analysis to identify functionally linked residues

  • Integration with experimental data:

    • Mapping of experimentally verified functional sites

    • Correlation of sequence variation with phenotypic differences

    • Cross-referencing with proteomics data

This multilayered approach can identify:

  • Essential domains for protein function

  • Potential therapeutic targets

  • Antigenic regions for vaccine development

  • Structural features governing protein-protein interactions

What emerging technologies could advance our understanding of PsHV-1 Envelope glycoprotein I biology?

Several cutting-edge technologies hold promise for advancing our understanding of PsHV-1 gI:

  • Single-molecule techniques:

    • Super-resolution microscopy to visualize gI distribution and dynamics on virions and infected cells

    • Single-molecule FRET to monitor conformational changes

    • Optical tweezers to measure forces involved in gI-mediated membrane interactions

  • Advanced structural biology approaches:

    • Cryo-electron tomography of intact virions to visualize gI in its native environment

    • AlphaFold2 and other AI-based structure prediction to model gI-gE complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Genome editing technologies:

    • CRISPR/Cas9-based screens to identify host factors interacting with gI

    • Base editing for precise modification of gI functional domains

    • CRISPR interference/activation to modulate gI expression

  • Systems biology approaches:

    • Proteomics to identify the complete interactome of gI

    • Transcriptomics to reveal host response to gI expression

    • Computational modeling of virus-host interaction networks

  • Organoid and organ-on-chip technologies:

    • Avian respiratory epithelial organoids to study gI function in a physiologically relevant context

    • Multi-cell type organ-on-chip systems to investigate cell-to-cell spread

These technologies can address complex questions such as:

  • How does gI dynamically reorganize during virus attachment and entry?

  • What is the complete set of host factors influenced by gI expression?

  • How do subtle structural changes in gI affect pathogenicity?

  • What are the key determinants of tissue tropism mediated by gI?

How might PsHV-1 Envelope glycoprotein I research contribute to broader understanding of herpesvirus pathogenesis?

Research on PsHV-1 gI has implications beyond avian herpesviruses:

  • Comparative virology insights:

    • Understanding conserved mechanisms of herpesvirus envelope glycoprotein function

    • Evolutionary adaptations to different host species

    • Common principles of viral immune evasion strategies

  • Translational applications:

    • Development of broad-spectrum antiviral strategies targeting conserved aspects of herpesvirus gI function

    • Cross-protective vaccine approaches based on conserved epitopes

    • Novel diagnostic platforms applicable to multiple herpesvirus infections

  • Host-pathogen interaction principles:

    • Mechanisms of viral manipulation of cellular trafficking pathways

    • Strategies for cell-to-cell viral transmission

    • Viral adaptation to host immune pressures

  • One Health implications:

    • Understanding viral transmission at the wildlife-domestic animal interface

    • Ecological factors influencing herpesvirus evolution

    • Surveillance strategies for emerging herpesvirus threats

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.