Recombinant Psittacid herpesvirus 1 Envelope protein UL45 (UL45)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your preparation.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
UL45; Envelope protein UL45
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-301
Protein Length
full length protein
Species
Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) (PsHV-1) (Pacheco's disease virus)
Target Names
UL45
Target Protein Sequence
MRPNGARTQTAPPPAAAEGTADVHGNGEAATIQLDGQPSAPSPPLTTVFEATDDYKARRR NLESEPPFEVRAILDDELSDYPVAAPLDAVPQKHSCCCGVCLRRCAFVLTGMAVGMLLAA ALLATIAAFAVPESVWTGGVCERGWVQHMGVCYKPGRTPPPSSAADGNFSAATFAGANTN CAAAGGSIVSSDQALSFLVLLSKTASGPNSAPPRGSWWTTHSGSCAIVHYAPSSTLEVYG NTSSLQSLALRTRDALDVSIAEDTQCSGSAGVMCAAAPAPPTALKYAQALRAILTLGVRA E
Uniprot No.

Target Background

Function

Appears essential for glycoprotein B-mediated fusion.

Database Links

KEGG: vg:2656963

Protein Families
Herpesviridae HHV-1 UL45 family
Subcellular Location
Virion membrane; Single-pass type II membrane protein.

Q&A

What is the genomic context of UL45 in PsHV-1?

PsHV-1 has a genome of approximately 163,025 bp with 73 predicted open reading frames (ORFs) . While specific information about PsHV-1 UL45 is limited in current literature, comparative genomic analysis shows structural similarities with other alphaherpesvirus UL45 homologs. PsHV-1 is most closely related to the alphaherpesvirus ILTV (infectious laryngotracheitis virus), suggesting its UL45 may share functional characteristics with ILTV's counterpart .

How is UL45 structurally characterized across herpesviruses?

In herpes simplex virus (HSV), UL45 encodes a 172 residue (~18 kilodalton) type II membrane protein that lacks consensus sites for N-linked glycosylation . This non-glycosylated viral envelope protein is expressed late in the infection cycle and has been characterized as dispensable for growth in certain cell lines like Vero cells . Researchers investigating PsHV-1 UL45 should examine whether it maintains these structural features or demonstrates psittacid-specific adaptations.

What experimental systems are appropriate for UL45 expression studies?

For initial characterization, chicken embryo fibroblasts (CEF) have been successfully used for PsHV-1 propagation . When studying UL45 specifically, researchers should consider:

Cell SystemAdvantagesLimitationsKey Considerations
CEFEstablished for PsHV-1 propagationNot natural host cellsMonitor for CPE at 6 days post-infection
Psittacine-derived cellsMore biologically relevantLimited availabilityMay require optimization of culture conditions
Recombinant expression systemsControlled expression of isolated proteinLacks viral contextUseful for structure-function studies

Viral isolation protocols typically involve PEG 8000 precipitation followed by purification through sucrose cushion centrifugation .

What is known about UL45 protein function in herpesviruses?

In HSV-1, the UL45 protein plays a critical role in mediating cell-cell fusion, particularly in syncytial (syn) mutant strains . Experiments with HSV-1 demonstrated that:

  • UL45 is required for full expression of cell-cell fusion induced by glycoprotein B (gB) syncytial mutants .

  • Deletion or mutation of UL45 can render syncytial strains non-syncytial, without affecting virus-cell fusion during entry .

  • UL45 appears to functionally interact with gB to regulate membrane fusion events .

Researchers investigating PsHV-1 UL45 should examine whether it serves similar fusion-mediating functions in the context of avian host cells.

How can researchers effectively detect and quantify UL45 expression?

Based on HSV-1 studies, researchers should consider complementary approaches:

  • Transcriptional analysis: Northern blot analysis using UL45-specific probes can detect the characteristic mRNA transcript (approximately 0.73 kb in HSV) .

  • Protein detection: Western immunoblotting using either infected cell lysates or virion-enriched preparations with UL45-specific antibodies .

  • Imaging approaches: Immunofluorescence microscopy to visualize UL45 localization during infection.

When developing detection protocols, researchers should be aware that UL45 and glycoprotein C (gC) transcripts are 3' coterminal in HSV systems, which may affect primer design for RT-PCR based approaches .

How does UL45 contribute to viral entry mechanisms?

Methodology for investigating entry mechanisms should include:

  • Viral entry assays using pH-dependent and pH-independent pathways

  • Acid inactivation experiments to assess virion sensitivity to low pH

  • Reporter-based fusion assays to distinguish between entry and fusion events

What approaches are effective for generating recombinant UL45 mutants?

Researchers have successfully used cotransfection methods to generate UL45 mutants in HSV-1 . A systematic approach includes:

  • PCR amplification of wild-type or mutant UL45 gene fragments

  • Cotransfection with viral genomic DNA in permissive cells

  • Screening resulting viruses for phenotypic changes (e.g., syncytium formation)

  • Confirmatory sequencing to identify specific genetic alterations

  • Complementation assays to verify phenotype-genotype relationships

When a UL45 deletion mutant of HSV-1 (A4B) was cotransfected with wild-type UL45 gene, restoration of UL45 expression correlated with restoration of the syncytial phenotype, confirming the functional relationship .

How should researchers approach contradictory results in UL45 functional studies?

Contradictory research findings are common challenges in virology. When encountering conflicting results regarding UL45 function, consider these methodological approaches:

  • Examine experimental systems: Different cell types or viral strains might yield varying results regarding UL45 function. For example, UL45 deletion in HSV-1 affects cell-cell fusion but not virus-cell fusion during entry .

  • Consider contextual factors: UL45 may interact with other viral proteins (particularly gB) in strain-specific ways. Document experimental conditions thoroughly, including:

    • Cell types and passage numbers

    • Viral strains and passage history

    • Timing of observations post-infection

    • Detection methods and reagents used

  • Data mining and curation: As noted by research methodologists, careful data examination is key for resolving contradictions . This includes:

    • Evaluating methodological differences between studies

    • Assessing statistical approaches and sample sizes

    • Considering positive result bias in published literature

How can complementary quantitative and qualitative approaches strengthen UL45 research?

When quantitative findings seem to contradict qualitative observations about UL45 function, researchers should recognize that both approaches provide valuable but different insights . Consider integrating:

  • Quantitative approaches:

    • Measuring fusion efficiency with precise metrics

    • Quantifying UL45 expression levels using Western blot densitometry

    • Statistical analysis of entry kinetics

  • Qualitative approaches:

    • Visual assessment of syncytium formation patterns

    • Immunofluorescence visualization of UL45 localization

    • Descriptive analysis of cytopathic effects

Rather than assuming one approach must be correct, recognize that they may be addressing different aspects of UL45 biology or reflecting different experimental contexts .

What methodological approaches are recommended for UL45 phylogenetic analysis?

For researchers conducting phylogenetic studies of UL45:

  • Sequence alignment tools like Geneious software can align UL45 sequences across herpesvirus species .

  • Tree topology with bootstrap re-sampling (minimum 1000 replicates) provides statistical support for evolutionary relationships .

  • BLAST searches of UL45 against comprehensive viral databases can identify distant homologs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.