Recombinant Psittacid herpesvirus 1 Uncharacterized protein UL-1 (UL-1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
UL-1; Uncharacterized protein UL-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-433
Protein Length
full length protein
Species
Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) (PsHV-1) (Pacheco's disease virus)
Target Names
UL-1
Target Protein Sequence
MEVARDGIMHPVDDFLMVVKAAMLEMMMMGKMAERYYYYVQLAFKMLVGVLKNLPVVYSY RYDAREYITETSNAVLGDDEVFEFGSSGEMVNSFLAFLRRALDWCAKFDEPPDMGGHGIE FMYPTRPTRIQRSTMGYFVRPKVPAAIVADAAVAAANLHFSNQVGEVSVRVPSRDLQPGE AGPSSSGGGRRDPAQANRGPVARVTPFVVERRYEEGEPGENGDESDEDGGRMDGDEDAAQ SEQNNDDGMDYESDVTDHSSAWGEEPDRRHDAEAGERGSERSGSNSEADERRRSYENDDI QVDVTSVSEDSESDGDFEERRDARIRGATADAPRPRRGEREEDDERGEGAANDGGRRPAR RDSPDSVIVIDDTSSSEDETFPPVLWLQRRDDPRTLLSRTRRAASRTRTIGGTRPRSRSP HRRGEGRDLPEDN
Uniprot No.

Target Background

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is Psittacid herpesvirus 1 and its significance in avian pathology?

Psittacid herpesvirus 1 (PsHV-1) is the causative agent of Pacheco's disease, an acute, highly contagious, and potentially lethal respiratory herpesvirus infection affecting psittacine birds. This virus is of significant concern in companion bird markets and exotic bird breeding, with Amazon parrots, macaws, and cockatoos showing particularly high susceptibility . The virus primarily targets hepatocytes and lymphocytes and forms syncytial plaques slowly in tissue culture systems .

PsHV-1 has historically been classified in both the betaherpesvirus and gammaherpesvirus families, though phylogenetic analyses based on UL16 and UL30 gene sequences have revealed that PsHV-1 is most closely related to the alphaherpesvirus infectious laryngotracheitis virus (ILTV) . This relationship positions PsHV-1 in a unique classification position among avian herpesviruses.

What is the genomic organization of PsHV-1?

PsHV-1 exhibits a class D herpesvirus genome structure, similar to pseudorabies virus (PRV) and varicella-zoster virus (VZV). The complete genome is 163,025 base pairs with a G+C content of 60.95% . The genome contains:

  • A unique long (UL) region of 119,146 bp

  • A unique short (US) region of 16,405 bp

  • Inverted repeat elements, each 13,737 bp in length

This genomic structure allows for the US region to invert relative to the UL domain, resulting in two equimolar isomeric forms of the genome. The PsHV-1 genome encodes 73 predicted open reading frames (ORFs), which is comparable to but distinct from the 77 ORFs found in the related ILTV genome (148,665 bp, 48.16% G+C content) .

How is recombinant PsHV-1 UL-1 protein expressed and purified for research use?

Recombinant PsHV-1 UL-1 protein can be produced using prokaryotic expression systems, primarily E. coli . The typical workflow involves:

  • Cloning: The full-length UL-1 gene (encoding amino acids 1-433) is cloned into an appropriate expression vector with a His-tag (commonly N-terminal) .

  • Expression: Transformation into E. coli expression strains, followed by induction of protein expression under optimized conditions .

  • Purification: Affinity chromatography using the His-tag, followed by additional purification steps if needed to achieve >90% purity as determined by SDS-PAGE .

  • Processing: The purified protein is typically lyophilized into powder form for extended shelf life and ease of storage .

For researchers working with this protein, it's essential to validate expression and folding through techniques such as Western blotting, mass spectrometry, and activity assays specific to the predicted function of the protein.

What are the optimal storage and handling conditions for recombinant UL-1 protein?

To maintain the stability and activity of recombinant UL-1 protein, the following storage and handling protocols are recommended:

  • Long-term storage: Store lyophilized protein at -20°C to -80°C upon receipt .

  • Aliquoting: Divide reconstituted protein into small working aliquots to avoid repeated freeze-thaw cycles, which can degrade the protein .

  • Reconstitution: Briefly centrifuge the vial prior to opening to bring contents to the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Cryoprotection: Add glycerol to a final concentration of 5-50% (50% is the default recommendation) before aliquoting for long-term storage at -20°C/-80°C .

  • Working solutions: Store working aliquots at 4°C for up to one week to minimize degradation .

These recommendations are based on standard protocols for maintaining protein stability while preventing degradation through proteolysis, denaturation, or aggregation.

What experimental approaches can characterize the function of the uncharacterized UL-1 protein?

Given the limited functional information about UL-1, researchers might employ the following approaches:

  • Structural Analysis:

    • Circular dichroism (CD) spectroscopy to determine secondary structure elements

    • X-ray crystallography or cryo-EM for three-dimensional structure determination

    • In silico modeling and prediction based on the amino acid sequence

  • Interaction Studies:

    • Co-immunoprecipitation to identify binding partners

    • Yeast two-hybrid screening to detect protein-protein interactions

    • Pull-down assays using the recombinant protein as bait

  • Functional Assays:

    • Gene knockout or knockdown studies in viral culture systems

    • Complementation assays to determine if UL-1 can restore function in viral mutants

    • Reporter gene assays to detect potential regulatory functions

  • Localization Studies:

    • Immunofluorescence microscopy to determine subcellular localization

    • Fractionation studies to identify the compartment where UL-1 operates

    • Live-cell imaging with fluorescently tagged UL-1

  • Expression Pattern Analysis:

    • RT-PCR or RNA-seq to determine temporal expression during infection

    • Western blotting to monitor protein levels during different stages of infection

These multifaceted approaches would provide complementary data to help elucidate the function of this uncharacterized protein in viral pathogenesis.

How does PsHV-1 UL-1 compare to homologous proteins in related herpesviruses?

Comparative analysis reveals limited sequence homology between PsHV-1 UL-1 and proteins from related herpesviruses. The UL-1 protein shares only 24-26% identical amino acids with respective proteins from equine herpesviruses (EHV-1, EHV-4) and shows limited homology to HSV-1 (human herpes simplex virus 1) . This low sequence conservation suggests potential functional divergence despite the structural similarities in viral genome organization.

The divergence in sequence but conservation in genome organization highlights the complex evolutionary history of herpesviruses, where selective pressures may maintain certain structural features while allowing functional innovation at the protein level.

What insights can be gained from studying UL-1 in the context of avian herpesvirus evolution?

Studying UL-1 in the context of avian herpesvirus evolution offers several valuable insights:

  • Evolutionary Adaptation: The limited sequence homology between UL-1 and proteins from mammalian herpesviruses suggests potential adaptation to avian hosts. Investigating these differences may reveal host-specific interaction mechanisms.

  • Functional Divergence: Comparative studies can help identify conserved domains that may indicate essential functions versus variable regions that might contribute to host range and tissue tropism differences between avian herpesviruses.

  • Phylogenetic Classification: Further characterization of UL-1 could contribute to refining the phylogenetic classification of PsHV-1, which has been variously classified as beta-, gamma-, and alphaherpesvirus .

  • Host-Pathogen Co-evolution: Analysis of UL-1 variants across different PsHV-1 isolates from various psittacine species could reveal patterns of host-pathogen co-evolution and adaptation.

These evolutionary perspectives can guide targeted functional studies and potentially reveal novel mechanisms in herpesvirus pathogenesis that are specific to avian hosts.

What are the challenges in expressing and purifying functional UL-1 protein?

Researchers working with recombinant UL-1 protein face several technical challenges:

  • Solubility Issues: Viral proteins often contain hydrophobic domains that can cause aggregation and inclusion body formation in bacterial expression systems. Optimization of expression conditions (temperature, induction strength) or use of solubility tags may be necessary.

  • Proper Folding: E. coli lacks many post-translational modification systems present in eukaryotic cells, which may affect the folding and function of UL-1. Alternative expression systems (insect cells, mammalian cells) might be needed for studying the fully functional protein.

  • Stability Concerns: The recommendation to avoid repeated freeze-thaw cycles indicates potential stability issues . Researchers should consider buffer optimization and addition of stabilizing agents to maintain protein integrity during storage and handling.

  • Functional Validation: As an uncharacterized protein, there are no established activity assays for UL-1, making it challenging to confirm that the recombinant protein retains its native function. Development of functional assays would be a priority for advanced research.

  • Structural Complexity: The full-length protein (433 amino acids) may contain multiple domains with different properties, complicating expression and purification strategies. Domain-based approaches might be necessary.

These challenges highlight the need for careful optimization and validation strategies when working with recombinant UL-1 protein in research settings.

How might UL-1 contribute to PsHV-1 pathogenesis and host specificity?

While the specific function of UL-1 remains uncharacterized, several hypotheses can be proposed based on knowledge of herpesvirus biology:

  • Host Range Determination: Given the low sequence homology with other herpesvirus proteins, UL-1 might contribute to the specific tropism of PsHV-1 for psittacine birds, particularly the high susceptibility observed in Amazon parrots, macaws, and cockatoos .

  • Immune Evasion: Many herpesvirus proteins are involved in modulating or evading host immune responses. UL-1 might play a role in countering psittacine-specific immune mechanisms.

  • Replication Regulation: The protein could be involved in regulating viral gene expression or DNA replication in a cell-type specific manner, contributing to the virus's ability to target hepatocytes and lymphocytes .

  • Viral Assembly and Egress: UL-1 might function in virion assembly, morphogenesis, or the egress pathway in infected cells, potentially in a way that is adapted to psittacine cell biology.

  • Latency Establishment: Herpesviruses typically establish latent infections, and UL-1 could play a role in the establishment, maintenance, or reactivation from latency in specific cell types.

Testing these hypotheses would require a combination of in vitro and in vivo approaches, including the development of recombinant viruses with mutations in the UL-1 gene, followed by assessment of replication, pathogenesis, and host range.

What control experiments should be included when working with recombinant UL-1 protein?

When designing experiments with recombinant UL-1 protein, researchers should include the following controls:

  • Expression Tag Controls: Since the recombinant protein contains a His-tag , experiments should control for potential tag-related effects by:

    • Using a different tagged version of the protein (e.g., GST-tagged UL-1)

    • Testing a tag-only protein preparation

    • When possible, comparing with an untagged version of the protein

  • Denaturation Controls: For structural or binding studies, include:

    • Heat-denatured UL-1 protein

    • Chemically denatured samples (e.g., with high urea or guanidinium concentrations)

  • Species-Specific Controls:

    • Homologous proteins from related herpesviruses (if available)

    • Proteins from unrelated viruses with similar predicted functions

  • Activity Validation Controls:

    • Dose-response assessments

    • Time-course experiments

    • Competition assays with predicted ligands or binding partners

These controls will help distinguish specific effects related to UL-1 function from artifacts related to the recombinant nature of the protein or experimental conditions.

What bioinformatic tools can help predict UL-1 function based on sequence analysis?

Given the uncharacterized nature of UL-1, bioinformatic approaches can provide valuable initial insights:

  • Protein Domain Prediction:

    • PFAM, SMART, and InterPro for identifying conserved domains

    • TMHMM and TOPCONS for transmembrane region prediction

    • SignalP for signal peptide prediction

  • Structural Prediction:

    • AlphaFold or RoseTTAFold for 3D structure prediction

    • PSIPRED for secondary structure prediction

    • DisProt for detecting intrinsically disordered regions

  • Functional Prediction:

    • BLAST and PSI-BLAST for detecting distant homologs

    • Gene Ontology (GO) term prediction tools

    • NetPhos for phosphorylation site prediction

    • SUMOplot for SUMOylation site prediction

  • Evolutionary Analysis:

    • MEGA for phylogenetic tree construction

    • ConSurf for identifying conserved functional residues

    • Coevolution analysis for detecting functionally linked residues

  • Protein-Protein Interaction Prediction:

    • STRING database for potential interaction partners

    • PRISM for structural interface prediction

These computational approaches can generate testable hypotheses about UL-1 function that can guide subsequent experimental design, particularly valuable for an uncharacterized protein with limited homology to known proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.