Recombinant Psittacid herpesvirus 1 Virion egress protein UL34 (UL34)

Shipped with Ice Packs
In Stock

Description

General Information

Psittacid herpesvirus 1 (PsHV-1) causes Pacheco's disease, a highly contagious and potentially lethal respiratory disease . UL34 is a type II membrane protein that resides in the endoplasmic reticulum and nuclear membranes . It is a conserved member of the herpesvirus nuclear egress complex, crucial for the egress of DNA-containing capsids from the nucleus, and optimal viral DNA replication and packaging into capsids .

Role in Herpesvirus Nucleocapsid Egress

During herpes simplex virus 1 (HSV-1) infection, the viral UL31 protein forms a complex with the UL34 protein at the cellular nuclear membrane, where both proteins are important for the envelopment of viral nucleocapsids and their egress into the cytoplasm .

Interaction with UL31

UL34 interacts directly with UL31, a soluble nucleoplasmic phosphoprotein . Co-expression of UL31 and UL34 can localize UL31 to the nucleoplasmic face of the inner nuclear membrane via its interaction with UL34 . In vitro, UL31 and UL34 can direct the formation of vesicles from the inner nuclear membrane .

Impact of UL34 on the Endoplasmic Reticulum

UL34 influences the organization of the endoplasmic reticulum in cells infected with HSV-1 . In UL34-null mutant viruses, UL31 appears as a distinct, smooth line localized to the nuclear rim in HEp-2 cells infected with wild-type HSV-1(F), whereas it is localized to and diffusely distributed throughout the nucleus and is colocalized with a nuclear viral protein, UL12, in cells infected with YK722(ΔUL34) .

UL34 as a Target for Anti-Herpetic Strategies

Alterations in UL34 function can drastically impair primary envelopment of HSV-1 and trap nucleocapsids in the nucleus . Bioinformatics analysis suggests that the nuclear egress factor pUL34 and its orthologs from all herpesviruses retain the fold of a pleckstrin homology (PH) . This may lead to the development of novel anti-herpetic therapeutic strategies where analogs of phosphoinositides are applied .

UL24 Protein and Viral Pathogenicity

The herpesvirus gene UL24 encodes a highly conserved core protein that plays an important role in effective viral infection . The UL24 protein can inhibit the innate immune response of the host by acting on multiple immune signaling pathways during virus infection, and it also plays a key role in the proliferation and pathogenicity of the virus in the later stage of infection . The UL24 protein acts as a virulence factor for the herpesvirus and plays a crucial role in its pathogenicity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
NEC2; UL34; Nuclear egress protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
full length protein
Species
Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) (PsHV-1) (Pacheco's disease virus)
Target Names
NEC2
Target Protein Sequence
MRSDKYSQLVSVVNAGLGACGTSATLVYIRNNARVAPTGDIITLPARLDGPPIPAEYILE AMTSLLSIRTAWLRIQNTGQAVIVAGCSTQNFHHGDVTWEPPASTVTLTTAKSLWVSASA VREMKVIQRIRTAPLAAMMFMCFYRGGKNEVTVRFAFYKSDSEPNLLKISKCVYEAIDAE ATRNLPKPRGFDTPPCAVLAQRMRPLGAAEGGDRETSAQTHSPAAQAQHVMQHATATKSW GALGRTLKHKKNLGWILFTCALSLAAAFVTAYIK
Uniprot No.

Target Background

Function

UL34 plays a crucial role in virion nuclear egress, the initial step of virion release from infected cells. Within the host nucleus, UL34 interacts with the newly formed capsid via its vertices, directing it to the inner nuclear membrane through its association with NEC2. It initiates capsid budding at the inner nuclear membrane and its subsequent envelopment within the perinuclear space. The UL34/NEC2 complex facilitates fusion of the enveloped capsid with the outer nuclear membrane, releasing the viral capsid into the cytoplasm for transport to secondary budding sites in the Golgi apparatus or trans-Golgi network.

Database Links

KEGG: vg:2657011

Protein Families
Herpesviridae NEC2 protein family
Subcellular Location
Host nucleus inner membrane; Single-pass membrane protein.

Q&A

What is the fundamental role of UL34 in herpesvirus replication?

UL34 serves as an essential component in the nuclear egress of herpesviruses. During the viral replication cycle, transcription, DNA replication, capsid formation, and DNA packaging occur within the nucleus . For virion maturation to proceed, nucleocapsids must exit the nucleus through a process called primary envelopment, which involves budding through the inner nuclear membrane.

The UL34 protein is a C-terminally anchored membrane protein located in the nuclear membrane with the majority of the protein exposed on the nuclear side . It functions in close association with the UL31 protein, forming the nuclear egress complex (NEC). This complex is critical for the primary envelopment process.

Mutation or deletion of the UL34 gene results in a drastic impairment of primary envelopment, leading to the retention of naked nucleocapsids in the cytoplasm and absence of mature virus particles . Electron microscopy of cells infected with UL34-negative viruses reveals accumulation of capsids in the nucleus, confirming UL34's essential role in nuclear egress .

How conserved is UL34 across different herpesvirus species?

UL34 is highly conserved throughout the Herpesviridae family, underscoring its fundamental importance in viral replication . The conservation extends to the interaction between UL34 and UL31, which has been demonstrated in various herpesviruses including HSV-1 and pseudorabies virus (PrV).

While sequence similarity may vary between distant herpesvirus species, the structural and functional characteristics of UL34 appear to be maintained. Particularly, the pleckstrin homology (PH) fold predicted in UL34 homologs suggests conservation of phosphoinositide-binding capability across different herpesvirus species .

The high degree of conservation makes UL34 a potential broad-spectrum target for antiviral development, as interventions targeting conserved functional domains might be effective against multiple herpesvirus species, potentially including Psittacid herpesvirus 1.

What structural domains have been identified in UL34?

UL34 contains several functionally important domains that contribute to its role in nuclear egress:

  • C-terminal transmembrane domain: Anchors the protein to the nuclear membrane with the majority of the protein extending into the nucleoplasm .

  • Interaction domain for UL31: Studies of point and deletion mutants have mapped the region involved in direct interaction with UL31 to a 45 amino acid interval between codons 137 and 181 in HSV-1 UL34 .

  • Pleckstrin homology (PH) fold: Structural prediction analyses suggest that the conserved domain of UL34 likely adopts this fold, which is typically associated with phosphoinositide binding .

  • Charged amino acid patches: Characterization of UL34 by Bjerke et al. (2003) identified six short patches of charged amino acids that are essential for the proper function of this viral protein .

The predicted phosphoinositide-binding capability through the PH domain provides a potential molecular mechanism for how UL34 interacts with nuclear membranes during viral egress, representing a significant advancement in our understanding of herpesvirus morphogenesis.

How does the interaction between UL34 and other viral proteins facilitate nuclear egress?

The interaction of UL34 with other viral proteins, particularly UL31, is crucial for nuclear egress. These interactions form a complex network that orchestrates the movement of nucleocapsids across the nuclear membrane:

  • UL34-UL31 Complex Formation: UL34 and UL31 interact directly, as demonstrated by yeast two-hybrid and coimmunoprecipitation studies . The UL31 protein is a phosphoprotein that is targeted to the nuclear membrane only in the presence of UL34 . This interaction appears to be the foundation of the nuclear egress complex.

  • Parallel Pathways: Studies with UL34, UL48, and double-negative PrV mutants revealed that defects in these proteins lead to similar phenotypes - reduced plaque sizes, decreased virus titers, and delayed neuroinvasion in infected mice . This suggests that UL34 and UL48 may operate in parallel pathways during virion morphogenesis.

  • Membrane Association: UL34 associates tightly with cytoplasmic membranes, providing an anchor point for the assembly of other viral components at the nuclear membrane . This membrane association is essential for proper localization of the egress machinery.

  • Interaction with Nuclear Lamina: UL34 likely affects the architecture of the nuclear lamina, potentially through recruiting cellular kinases that phosphorylate lamins, allowing nucleocapsids access to the inner nuclear membrane for envelopment .

The molecular details of these interactions provide potential targets for antiviral interventions that could disrupt the nuclear egress process and inhibit viral replication.

What is the significance of UL34's predicted phosphoinositide-binding capability?

The prediction that UL34 adopts a pleckstrin homology (PH) fold capable of binding phosphoinositides has significant implications for understanding its function and developing antiviral strategies:

  • Membrane Targeting Mechanism: The phosphoinositide-binding capability could explain how UL34 targets specific membrane domains within the nuclear envelope, as phosphoinositides are not uniformly distributed in cellular membranes .

  • Membrane Curvature Induction: Interaction with phosphoinositides might enable UL34 to induce or stabilize membrane curvature required for the budding process during primary envelopment.

  • Signaling Pathway Modulation: Phosphoinositides are important signaling molecules that regulate various cellular processes. UL34 binding to these lipids might modulate signaling pathways to create a favorable environment for viral replication.

  • Novel Therapeutic Target: As suggested in the research, analogs of phosphoinositides could potentially be developed as inhibitors of UL34 function, providing a new class of antiviral compounds . A detailed inspection of the ligand binding site strongly supports the hypothesis that UL34 orthologs can recognize phosphoinositides .

Understanding this aspect of UL34 function represents a significant advancement in our knowledge of herpesvirus biology and opens new avenues for antiviral development.

How do mutations in UL34 affect viral replication and pathogenesis?

Studies of UL34 mutants have provided valuable insights into the role of this protein in viral replication and pathogenesis:

  • Replication Defects: All UL34 deletion mutants show significantly reduced plaque sizes and virus titers in cultured cells compared to wild-type viruses . This indicates that UL34 is essential for efficient viral replication.

  • Morphogenesis Defects: Electron microscopy of cells infected with UL34-negative viruses reveals retention of naked nucleocapsids in the cytoplasm and absence of mature virus particles . This confirms that UL34 is critical for the primary envelopment process.

  • Pathogenesis Attenuation: In animal models, UL34-deficient viruses show delayed neuroinvasion following intranasal infection . This demonstrates that the defects observed in cell culture translate to reduced pathogenicity in vivo.

  • Domain-Specific Effects: Studies of point mutations have identified specific regions of UL34 that are critical for its function, including the UL31 interaction domain and charged amino acid patches . Mutations in these regions can result in non-functional proteins despite normal expression levels.

These findings collectively highlight the essential nature of UL34 in herpesvirus replication and pathogenesis, making it an attractive target for antiviral strategies.

What are the optimal approaches for generating recombinant UL34 proteins for structural and functional studies?

Several approaches can be employed for generating recombinant UL34 proteins, each with specific advantages depending on the research objectives:

  • Expression Systems Selection:

    • Bacterial expression (E. coli): Suitable for producing soluble domains of UL34 without the transmembrane region

    • Baculovirus-insect cell systems: Better for full-length protein expression with proper post-translational modifications

    • Mammalian cell expression: Provides the most physiologically relevant modifications and folding environment

  • Protein Tagging Strategies:

    • N-terminal tags (His, GST, MBP): Facilitate purification while avoiding interference with the C-terminal membrane anchor

    • Fluorescent protein fusions: As demonstrated with EGFP-UL3.5 fusion proteins, these enable visualization in localization studies and can be used for immunoprecipitation experiments

    • Cleavable tags: Allow removal after purification to study native protein function

  • Solubilization Approaches for Membrane Proteins:

    • Detergent-based extraction: Various detergents (DDM, LDAO, etc.) can be tested to identify optimal solubilization conditions

    • Amphipol stabilization: For maintaining protein stability during purification

    • Nanodiscs or liposomes: For reconstitution into membrane-like environments for functional studies

  • Purification Strategy:

    • Multi-step chromatography: Typically involving affinity purification followed by size exclusion and/or ion exchange

    • On-column detergent exchange: To maintain protein stability during purification

    • Quality control through analytical SEC and dynamic light scattering

Selection of the appropriate expression and purification approach should be guided by the specific experimental requirements, whether for structural studies, interaction analyses, or functional assays.

What experimental approaches are most effective for studying UL34-UL31 interactions?

The interaction between UL34 and UL31 is critical for nuclear egress, and several complementary approaches can be used to study this interaction:

  • Yeast Two-Hybrid Analysis:

    • As demonstrated in the search results, this approach is effective for mapping interaction domains

    • Truncated constructs (e.g., UL3.5 codons 1-139, 1-43, or 20-224) can help identify minimal interaction regions

    • Controls for autoactivation are essential, as seen with LexA-UL48 fusion proteins

  • Coimmunoprecipitation Studies:

    • Using [35S]methionine- and [35S]cysteine-labeled lysates of infected cells provides sensitive detection

    • Specific antibodies or tagged proteins (e.g., EGFP-tagged UL3.5) facilitate pulldown experiments

    • Appropriate controls (e.g., gH-specific control antiserum) are crucial for confirming specificity

  • Fluorescence Microscopy for Colocalization:

    • Expression of fluorescently tagged proteins allows visualization of their subcellular localization

    • Immunofluorescence with specific antibodies can be used for untagged proteins

    • Confocal microscopy provides high-resolution analysis of colocalization

  • Protein Fragment Complementation Assays:

    • Split fluorescent protein or luciferase systems can detect protein interactions in living cells

    • Allows monitoring of interactions in real-time during viral infection

  • Surface Plasmon Resonance or Biolayer Interferometry:

    • For quantitative measurement of binding kinetics and affinity constants

    • Requires purified proteins but provides detailed binding parameters

  • FRET-based Assays:

    • For studying interactions in living cells with high spatial and temporal resolution

    • Can detect conformational changes upon complex formation

These approaches, used in combination, provide complementary information about the nature, specificity, and dynamics of the UL34-UL31 interaction.

How can researchers effectively analyze the phosphoinositide-binding properties of UL34?

Given the predicted pleckstrin homology (PH) fold and potential phosphoinositide-binding capability of UL34 , several specialized techniques can be employed to characterize this interaction:

  • Protein-Lipid Overlay Assays:

    • PIP strips containing various phosphoinositides spotted on membranes

    • Incubation with purified UL34 followed by detection with specific antibodies

    • Provides initial screening of binding specificity for different phosphoinositide species

  • Liposome Binding Assays:

    • Preparation of liposomes with defined phospholipid composition including specific phosphoinositides

    • Sedimentation or flotation assays to assess UL34 association with liposomes

    • Can be quantified by SDS-PAGE, Western blotting, or fluorescence techniques

  • Microscale Thermophoresis:

    • Label-free technology to measure interactions between proteins and small molecules

    • Requires minimal sample amounts and can be performed in solution

    • Provides binding affinities under near-native conditions

  • Isothermal Titration Calorimetry (ITC):

    • Direct measurement of binding thermodynamics

    • Provides complete thermodynamic profile (ΔH, ΔS, ΔG) and stoichiometry

    • No immobilization or labeling required

  • Surface Plasmon Resonance (SPR):

    • Real-time measurement of binding kinetics

    • Can use lipid monolayers or bilayers containing phosphoinositides

    • Provides association and dissociation rate constants

  • Mutagenesis Approaches:

    • Structure-guided mutagenesis of predicted phosphoinositide-binding residues

    • Functional testing of mutants in binding assays and viral context

    • Correlates structural predictions with functional outcomes

  • X-ray Crystallography or Cryo-EM:

    • Structural determination of UL34 in complex with phosphoinositide analogs

    • Provides atomic-level details of the interaction interface

    • May require protein engineering to remove flexible regions

These techniques would provide comprehensive characterization of UL34's phosphoinositide-binding properties, potentially leading to the development of phosphoinositide analogs as novel antiviral compounds .

What methods are most effective for generating and characterizing UL34 deletion mutants?

Generation and characterization of UL34 deletion mutants requires careful planning and specialized techniques:

  • Mutagenesis Strategies:

    • Red recombinase-mediated mutagenesis in E. coli: This approach has been successfully used for generating viral mutants

    • CRISPR-Cas9 genome editing: For precise modifications in viral genomes

    • BAC mutagenesis: Allows manipulation of the entire viral genome in bacterial systems

    • Marker cassette insertion followed by removal: Using FRT sites and Flp recombinase as described for UL3.5 deletion

  • Verification Methods:

    • Restriction analysis of viral DNA and Southern blot hybridization

    • PCR amplification and sequencing of the mutated genome regions

    • Western blot analysis to confirm protein expression (or absence)

    • Complementation tests with wild-type genes to confirm specificity of phenotypes

  • Phenotypic Characterization:

    • Plaque size measurement: All UL34 deletion mutants exhibit significantly reduced plaque sizes

    • Virus titer determination: Typically reduced in UL34 mutants

    • Growth kinetics analysis: To assess replication efficiency over time

    • Electron microscopy: To visualize the effects on virion morphogenesis and nuclear egress

  • In vivo Assessment:

    • Animal infection models: UL34 mutants show delayed neuroinvasion in intranasally infected mice

    • Tissue distribution analysis: To determine the effect on viral spread

    • Pathogenicity evaluation: To assess virulence attenuation

These approaches provide comprehensive characterization of UL34 mutants, allowing correlation between specific protein domains and viral functions.

How can researchers optimize coimmunoprecipitation experiments for studying UL34 interactions?

Coimmunoprecipitation (co-IP) is a powerful technique for studying protein-protein interactions, as demonstrated in the analysis of UL3.5-UL48 interactions . For UL34 interaction studies, several optimization strategies can enhance experimental success:

  • Cell Lysis Conditions:

    • Selection of appropriate lysis buffers that maintain protein interactions while efficiently solubilizing membrane proteins

    • Inclusion of protease inhibitors to prevent degradation

    • Optimization of detergent type and concentration (e.g., NP-40, Triton X-100, digitonin)

    • Consideration of crosslinking approaches for transient interactions

  • Antibody Selection and Validation:

    • If direct antibodies against UL34 are not suitable (as noted for UL3.5 ), tagging approaches can be employed

    • Fusion with EGFP or other tags facilitates immunoprecipitation with well-characterized antibodies

    • Pre-clearing of lysates to reduce non-specific binding

    • Inclusion of appropriate negative controls (e.g., gH-specific control antiserum as used in UL3.5-UL48 studies )

  • Detection Methods:

    • Metabolic labeling with [35S]methionine and [35S]cysteine enhances sensitivity for newly synthesized viral proteins

    • Western blotting with specific antibodies for known interaction partners

    • Mass spectrometry for unbiased identification of interaction partners

    • Sequential immunoprecipitation (re-IP) for confirming complex formation

  • Analysis of Temporal Dynamics:

    • Time-course experiments to capture interactions at different stages of infection

    • Pulse-chase studies to analyze the stability of protein complexes

    • Synchronization of infection to improve temporal resolution

  • Visualization Techniques:

    • Autoradiography for radiolabeled proteins

    • Fluorography for enhanced sensitivity

    • Digital imaging systems for quantitative analysis

These optimized co-IP approaches can provide valuable insights into the protein interaction network centered around UL34 during herpesvirus infection.

What are the key considerations for designing experiments to test phosphoinositide inhibitors against UL34?

The predicted phosphoinositide-binding capability of UL34 presents an opportunity for developing novel antiviral compounds. When designing experiments to test potential phosphoinositide inhibitors, several key considerations should be addressed:

  • Inhibitor Design and Selection:

    • Structure-based design of phosphoinositide analogs based on the predicted binding site in UL34

    • Consideration of lipid solubility, stability, and cellular uptake properties

    • Development of a panel of compounds with systematic modifications to establish structure-activity relationships

    • Use of non-hydrolyzable analogs to prevent metabolic degradation

  • In Vitro Binding Assays:

    • Competitive binding assays with natural phosphoinositides to determine inhibitor affinity

    • Surface plasmon resonance or isothermal titration calorimetry to measure binding constants

    • Fluorescence-based displacement assays for high-throughput screening

  • Cellular Assays:

    • Assessment of compound toxicity and cellular uptake

    • Localization studies of fluorescently tagged UL34 in the presence of inhibitors

    • Evaluation of effects on UL34-UL31 complex formation

    • Quantification of nuclear egress efficiency using fluorescence microscopy

  • Viral Replication Assays:

    • Determination of EC50 values for viral replication inhibition

    • Time-of-addition studies to confirm targeting of the nuclear egress step

    • Electron microscopy to visualize effects on virion morphogenesis

    • Selection and characterization of resistant mutants to confirm mechanism of action

  • Specificity Controls:

    • Testing against UL34-deficient viruses complemented with mutant UL34 proteins lacking phosphoinositide binding

    • Evaluation of effects on other phosphoinositide-binding viral or cellular proteins

    • Assessment of activity against multiple herpesvirus species to leverage the conservation of UL34

  • Structure-Activity Relationship Analysis:

    • Correlation between inhibitor binding affinity and antiviral activity

    • Identification of chemical moieties essential for activity

    • Optimization of lead compounds for improved potency and pharmacokinetic properties

These experimental approaches would provide a comprehensive evaluation of phosphoinositide-based inhibitors targeting UL34, potentially leading to a novel class of antiherpetic therapeutic agents .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.