Recombinant Psychrobacter arcticus ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
atpF; Psyc_2028; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Psychrobacter arcticus (strain DSM 17307 / 273-4)
Target Names
atpF
Target Protein Sequence
MNINSTLIGQAIAFAIFVMFCMKFVWPPLIGAINDRQRKIAEGLNAAEKAKADLATAERD VQQELDLAKTKAAALIEQANKSANQLVEDAKSQAQVEGERIRQQAQAAIDQEINQARESL RAQVAELAVLGAEKILQDKVDVQKHASMLDQLAAKL
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: F1, containing the extramembranous catalytic core, and F0, containing the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.

This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 and F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Psychrobacter arcticus and why is it significant for ATP synthase research?

Psychrobacter arcticus is a psychrophilic bacterium isolated from Siberian permafrost soil that can grow at temperatures as low as -10°C. This organism is the first cold-adapted bacterium from a terrestrial environment whose genome was sequenced . The significance of P. arcticus in ATP synthase research stems from its remarkable cold adaptation mechanisms that allow its proteins to function efficiently at subzero temperatures. The ATP synthase complex, including subunit b (atpF), likely contains structural modifications that maintain functionality in extreme cold, making it an excellent model for studying enzyme adaptation to low temperatures. Comparative genome analysis has shown that P. arcticus exhibits reduced use of acidic amino acids, proline, and arginine in its proteome, consistent with increased protein flexibility at low temperatures .

How does the structure and function of ATP synthase subunit b differ in psychrophilic bacteria compared to mesophilic organisms?

In psychrophilic bacteria like P. arcticus, ATP synthase subunit b likely exhibits characteristic adaptations that distinguish it from mesophilic counterparts:

Structural FeaturePsychrophilic ATP Synthase Subunit bMesophilic ATP Synthase Subunit b
Amino acid compositionReduced acidic amino acids, proline and arginineHigher content of rigid amino acids
Structural flexibilityEnhanced flexibility at low temperaturesMore rigid structure optimized for moderate temperatures
Salt bridges/H-bondsFewer stabilizing interactionsMore intramolecular stabilizing interactions
Hydrophobic coreLooser packing with more small residuesTighter packing with larger hydrophobic residues

These adaptations in P. arcticus proteins help maintain structural flexibility and catalytic efficiency at low temperatures where most enzymes would become too rigid to function properly . The modifications likely affect how subunit b interacts with other components of the ATP synthase complex while preserving its essential role in energy production under cold conditions.

What expression systems are most effective for producing recombinant P. arcticus ATP synthase subunit b?

For recombinant expression of P. arcticus ATP synthase subunit b, E. coli is typically the preferred heterologous host, but with specific modifications to accommodate the cold-adapted nature of the protein. Based on information from related recombinant proteins, the following methodology is recommended:

  • Expression vector selection: Vectors with strong, inducible promoters like pET systems with His-tags for purification are effective, similar to those used for other P. arcticus proteins .

  • Host strain selection: E. coli BL21(DE3) or Arctic Express strains that co-express cold-adapted chaperonins can improve folding of psychrophilic proteins.

  • Induction conditions: Lower temperatures (15-20°C) and reduced IPTG concentrations (0.1-0.5 mM) during induction help maintain proper folding.

  • Growth media: Defined media containing essential nutrients, similar to the basal defined medium developed for P. arcticus that includes lactic acid or sodium pyruvate, glutamate or NH₄Cl, K₂HPO₄, Wolin's vitamins, and trace minerals .

  • Post-expression handling: All purification steps should be performed at 4°C or lower to preserve the native structure and activity of this cold-adapted protein.

What methodological approaches can be used to assess the cold adaptation mechanisms of P. arcticus ATP synthase subunit b?

To investigate cold adaptation mechanisms in P. arcticus ATP synthase subunit b, researchers should implement a multi-faceted experimental approach:

  • Comparative sequence analysis: Align the amino acid sequence of P. arcticus atpF with mesophilic and thermophilic homologs to identify substitutions that may contribute to cold adaptation. Focus on regions with reduced acidic amino acids, proline, and arginine content, which have been identified as adaptive changes in the P. arcticus proteome .

  • Structural characterization: Employ X-ray crystallography or cryo-electron microscopy at various temperatures to capture temperature-dependent conformational changes. Complement with circular dichroism (CD) spectroscopy to assess secondary structure stability at different temperatures.

  • Molecular dynamics simulations: Model the flexibility of the protein at different temperatures to identify regions with enhanced mobility that might be crucial for function in cold environments.

  • Site-directed mutagenesis: Systematically replace residues unique to the psychrophilic enzyme with their mesophilic counterparts to assess their contribution to cold adaptation through activity assays at various temperatures.

  • Hydrogen-deuterium exchange mass spectrometry: Measure the rate of hydrogen-deuterium exchange to identify regions with increased flexibility that may be associated with cold adaptation.

How can researchers accurately measure the enzymatic activity of recombinant P. arcticus ATP synthase subunit b in isolation and as part of the ATP synthase complex?

Measuring the enzymatic activity of ATP synthase subunit b presents unique challenges as it functions as part of a complex rather than as an individual catalytic unit. Researchers should consider these methodological approaches:

  • Reconstitution studies: Incorporate purified recombinant subunit b into liposomes or nanodiscs along with other ATP synthase subunits to reconstruct a functional complex. ATP synthesis/hydrolysis can then be measured using:

    • Luciferin-luciferase assay for ATP production

    • NADH-coupled assay for ATPase activity

    • pH-sensitive probes to monitor proton translocation

  • Temperature-dependent kinetics: Assess activity across a temperature range (-10°C to 37°C) to determine:

    • Optimal temperature for activity

    • Activation energy (Ea) using Arrhenius plots

    • Thermostability profiles

  • Binding assays: Use surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to analyze interactions between subunit b and other components of the ATP synthase complex at different temperatures.

  • Crosslinking studies: Employ chemical crosslinking followed by mass spectrometry to identify interaction partners and conformational changes at different temperatures.

All experiments should be performed with appropriate controls, including mesophilic ATP synthase subunit b for comparison, to highlight the unique properties of the psychrophilic protein.

What challenges might researchers encounter when working with recombinant P. arcticus ATP synthase subunit b and how can these be addressed?

Researchers working with recombinant P. arcticus ATP synthase subunit b may encounter several challenges:

  • Protein instability at room temperature: Cold-adapted proteins often exhibit reduced stability at moderate temperatures.

    • Solution: Maintain low temperatures (0-4°C) throughout purification and storage. Consider adding stabilizing agents such as glycerol (6% Trehalose has been used for other P. arcticus proteins) .

    • Storage recommendation: Store at -20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles .

  • Low expression yields: Psychrophilic proteins may express poorly in standard systems.

    • Solution: Optimize codon usage for the expression host, use cold-inducible promoters, and express at lower temperatures (15-20°C) for extended periods.

  • Improper folding: The protein may misfold when expressed at temperatures higher than its native environment.

    • Solution: Co-express with cold-adapted chaperones or use E. coli Arctic Express strains designed for cold-adapted protein expression.

  • Difficulty in functional assays: As a structural component rather than an enzyme with catalytic activity, functional assessment is challenging.

    • Solution: Develop binding assays to measure interactions with partner subunits or reconstituion assays to assess function within the complex.

  • Contamination with proteases: Extended expression times at low temperatures may increase susceptibility to proteolytic degradation.

    • Solution: Include protease inhibitors during purification and consider using protease-deficient host strains.

How should researchers design experiments to compare the properties of P. arcticus ATP synthase subunit b with those from mesophilic and thermophilic organisms?

A comprehensive experimental design for comparative analysis should include:

  • Parallel expression and purification: Express and purify ATP synthase subunit b from P. arcticus (psychrophile), E. coli (mesophile), and a thermophilic organism (e.g., Thermus thermophilus) using identical tags and similar purification protocols.

  • Thermal stability assessment:

    • Differential Scanning Calorimetry (DSC) to determine melting temperatures (Tm)

    • Thermal shift assays using fluorescent dyes to monitor unfolding

    • Activity retention after incubation at various temperatures

  • Structural flexibility comparison:

    • Limited proteolysis to identify regions with differential flexibility

    • Intrinsic fluorescence measurements to assess tertiary structure changes

    • NMR spectroscopy to monitor dynamics at atomic resolution

  • Functional assessment across temperature ranges:

    • ATP synthesis/hydrolysis rates at temperatures from -10°C to 70°C

    • Proton translocation efficiency

    • Binding affinity to other subunits at different temperatures

  • Molecular basis of adaptation:

    • Comparative sequence analysis highlighting substitutions

    • Homology modeling to predict structural differences

    • Site-directed mutagenesis to create hybrid proteins with mixed properties

Data should be presented in temperature-activity profiles with statistical analysis of at least three biological replicates to ensure reliability.

What considerations are important when designing site-directed mutagenesis experiments to investigate cold adaptation in P. arcticus ATP synthase subunit b?

Site-directed mutagenesis experiments require careful planning:

How can researchers differentiate between amino acid adaptations specific to ATP synthase function versus general cold adaptation in the P. arcticus proteome?

Differentiating ATP synthase-specific adaptations from general cold adaptations requires sophisticated analytical approaches:

  • Comparative genomics across function:

    • Compare amino acid composition of ATP synthase subunits with other proteins from P. arcticus to identify adaptations that deviate from the general proteome trends

    • Focus on residues conserved in ATP synthases across thermophiles and mesophiles but altered in psychrophiles

  • Structural context analysis:

    • Map amino acid substitutions onto structural models to identify if changes cluster in functionally important regions

    • Analyze if substitutions occur preferentially at sites involved in catalysis, subunit interaction, or conformational changes

  • Evolutionary rate analysis:

    • Calculate dN/dS ratios (ratio of non-synonymous to synonymous substitutions) for ATP synthase genes compared to housekeeping genes

    • Higher ratios may indicate positive selection specific to ATP synthase function

  • Statistical approaches:

    • Use Principal Component Analysis (PCA) to distinguish patterns of amino acid usage in ATP synthase versus the general proteome

    • Apply machine learning algorithms to identify patterns associated specifically with ATP synthase cold adaptation

  • Experimental validation:

    • Perform complementation studies where psychrophilic ATP synthase genes are expressed in mesophilic hosts at low temperatures

    • Compare growth rates and ATP production to validate functional significance of adaptations

Genome analysis of P. arcticus has shown that differential amino acid usage occurred in all gene categories but was more common in gene categories essential for cell growth and reproduction, suggesting evolutionary pressure for cold adaptation .

What statistical methods are most appropriate for analyzing temperature-dependent activity data from recombinant P. arcticus ATP synthase experiments?

For robust analysis of temperature-dependent activity data, researchers should employ:

  • Arrhenius analysis:

    • Plot ln(k) versus 1/T (where k is the rate constant and T is temperature in Kelvin)

    • Calculate activation energy (Ea) from the slope (-Ea/R)

    • Identify non-linear Arrhenius plots that may indicate different rate-limiting steps at different temperatures

  • Temperature quotient (Q10) analysis:

    • Calculate Q10 values (ratio of rates when temperature increases by 10°C)

    • Compare Q10 values between psychrophilic, mesophilic, and thermophilic enzymes

    • Lower Q10 values typically indicate cold adaptation

  • Thermodynamic parameter calculations:

    • Determine changes in Gibbs free energy (ΔG‡), enthalpy (ΔH‡), and entropy (ΔS‡) of activation

    • Plot thermodynamic parameters against temperature to identify compensation effects

  • Non-linear regression models:

    • Fit data to models that account for both activation and inactivation processes

    • Use Boltzmann sigmoidal curves to determine temperature optima and transition temperatures

  • Statistical comparison methods:

    • ANOVA with post-hoc tests to compare activity parameters between wild-type and mutant enzymes

    • Multiple regression analysis to identify factors contributing most significantly to cold adaptation

    • Bootstrap resampling to estimate confidence intervals for kinetic parameters

All analyses should include appropriate controls and be performed on at least three independent experimental replicates to ensure statistical validity.

What recent advances in understanding cold-adapted ATP synthases might inform research on P. arcticus ATP synthase subunit b?

Recent advances that may inform P. arcticus ATP synthase subunit b research include:

  • Cryo-electron microscopy (cryo-EM) has revolutionized our understanding of ATP synthase structures, revealing dynamic conformational states that are particularly relevant for cold-adapted versions where structural flexibility is crucial.

  • Studies on other psychrophilic ATP synthases have identified specific amino acid substitutions that contribute to increased catalytic efficiency at low temperatures while often sacrificing thermal stability.

  • Advances in computational biology have enabled more accurate modeling of protein dynamics at different temperatures, providing insights into how subtle structural changes affect function in cold environments.

  • Emerging research on Psychrobacter species has identified unique metabolic adaptations that may influence ATP requirements and ATP synthase regulation in cold environments .

  • Recent comparative genomics approaches have revealed that cold adaptation strategies in P. arcticus include not only amino acid composition changes but also the presence of cold shock proteins that may interact with ATP synthase or regulate its expression .

What future research directions could advance our understanding of P. arcticus ATP synthase subunit b and its applications?

Future research directions with significant potential include:

  • Structural biology approaches:

    • Obtain high-resolution structures of P. arcticus ATP synthase at different temperatures using cryo-EM

    • Apply time-resolved structural methods to capture conformational dynamics during catalysis at low temperatures

  • Synthetic biology applications:

    • Engineer hybrid ATP synthases with subunits from organisms adapted to different temperature ranges

    • Develop cold-active energy production systems for biotechnological applications

  • Systems biology integration:

    • Study the regulation of ATP synthase expression in response to temperature shifts

    • Investigate interactions between ATP synthase and other cellular components in the cold adaptation network

  • Applied research directions:

    • Explore the potential of cold-adapted ATP synthase components as biocatalysts in industrial processes requiring low-temperature operations

    • Investigate applications in cryopreservation technologies where energy production at low temperatures is critical

  • Ecological and evolutionary perspectives:

    • Examine the diversity of ATP synthase adaptations across psychrophilic organisms from different environments

    • Reconstruct the evolutionary trajectory of cold adaptation in ATP synthase to understand the sequence and significance of adaptive changes

These research directions could significantly advance our understanding of life in extreme environments while potentially yielding biotechnological applications for energy production systems that function efficiently at low temperatures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.