Recombinant Psychrobacter arcticus Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please let us know, and we will prioritize its development.
Synonyms
dsbB; Psyc_0034; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Psychrobacter arcticus (strain DSM 17307 / 273-4)
Target Names
dsbB
Target Protein Sequence
MLQLTTYRNLQVFLVIMTAIGMSFALFFLQRYMGFSPCPLCIFQRIGLMIMGGFALIAAL FHPKSMVIRLLLWLGSLAGIGWAAIVAGRHVWLQHLPADQVPSCGPGLDYWLDTLPMQQV LKEVFAGSGECASIEWTFLGLSIPEQSLILFSILILTHLLILWRIVRPSTPKPLAR
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in some periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Psychrobacter arcticus and why is it significant for recombinant protein studies?

Psychrobacter arcticus belongs to a genus of psychrotolerant, Gram-negative, rod-shaped, aerobic bacteria frequently isolated from Arctic and Antarctic environments. These bacteria are extensively studied as model psychrotolerant microorganisms and have become important sources of cold-active enzymes for biotechnology . Their ability to grow at low temperatures makes them valuable hosts for the expression of cold-adapted proteins, including those involved in disulfide bond formation, which may retain functionality at lower temperatures compared to mesophilic counterparts.

What is the biological role of Disulfide Bond Formation Protein B (dsbB) in Psychrobacter arcticus?

In Psychrobacter arcticus, as in other bacteria, dsbB is part of the disulfide bond formation pathway that catalyzes the formation of disulfide bonds in periplasmic proteins. The dsbB protein functions by reoxidizing the DsbA protein, which directly introduces disulfide bonds into newly synthesized proteins. This oxidative folding system is crucial for the structural stability and function of many secreted and membrane proteins, particularly in cold environments where protein folding dynamics differ from those at mesophilic temperatures.

How does the genetic organization of Psychrobacter arcticus compare to other Psychrobacter species?

Psychrobacter species demonstrate considerable genetic diversity, with many strains harboring multiple plasmids. For instance, Psychrobacter sp. ANT_H3 carries as many as 11 extrachromosomal replicons, which is the highest number reported in Psychrobacter species . Comparative genomic analyses show that Antarctic Psychrobacter replicons differ significantly from plasmids isolated from other locations . Most Psychrobacter genomes contain stress response genes that confer protection against various environmental challenges including low temperature, increased ultraviolet radiation, oxidative stress, and osmotic pressure .

Which expression vectors are most suitable for recombinant Psychrobacter arcticus dsbB production?

Based on studies with various Psychrobacter strains, several vector systems have shown promise. Unlike early reports suggesting ColE1- and p15a-type replication systems were stable in P. arcticus 274-3, subsequent experiments with cold-active Psychrobacter strains showed these systems may not be universally applicable . Two novel shuttle vectors developed from the replication system of plasmid pP32BP2 from Psychrobacter sp. DAB_AL32B have demonstrated effectiveness: pPS-NR (Psychrobacter-Escherichia coli-specific) and pPS-BR (Psychrobacter-various Proteobacteria-specific) . These vectors offer increased carrying capacity suitable for cloning larger genes such as dsbB.

What culture conditions optimize the expression of functional recombinant dsbB from Psychrobacter arcticus?

For optimal expression of cold-active dsbB, cultivation temperature is critical. Most Psychrobacter strains grow optimally at 20-25°C , though expression of cold-adapted proteins may benefit from lower temperatures (10-15°C) to ensure proper folding. The culture medium should be supplemented appropriately based on the expression system used. For E. coli hosts expressing psychrophilic proteins, LB medium supplemented with appropriate antibiotics (e.g., kanamycin at 50 μg/ml) is commonly used . Since dsbB is a membrane protein involved in disulfide bond formation, expression conditions should avoid reducing agents that might interfere with disulfide bond stability.

What are the optimal methods for purifying recombinant dsbB while maintaining its native conformation?

Purification of membrane proteins like dsbB requires specialized approaches. A recommended protocol includes:

  • Cell lysis using low temperature buffer systems (pH 7.5-8.0)

  • Membrane fraction isolation through ultracentrifugation

  • Detergent solubilization (mild detergents like n-dodecyl-β-D-maltoside)

  • Affinity chromatography using a fusion tag system

  • Size exclusion chromatography for final purification

All steps should be performed at low temperatures (4-10°C) to maintain the structural integrity of this cold-adapted protein. Detergent selection is critical as it must effectively solubilize the membrane protein while preserving its native conformation and enzymatic activity.

How can researchers assess the activity and stability of recombinant Psychrobacter arcticus dsbB?

The activity of dsbB can be assessed through:

  • Coupled enzyme assays with DsbA and model substrates

  • Ubiquinone reduction assays that measure electron transfer

  • Complementation studies in dsbB-deficient bacterial strains

Stability can be evaluated by measuring:

  • Thermal denaturation profiles using circular dichroism spectroscopy

  • Activity retention after exposure to different temperatures

  • Long-term storage stability under various conditions

These assessments should be performed at both low (4-15°C) and moderate (20-30°C) temperatures to characterize the cold-adaptation features of P. arcticus dsbB compared to mesophilic counterparts.

What structural and functional differences exist between Psychrobacter arcticus dsbB and its mesophilic homologs?

While specific data for P. arcticus dsbB is limited in the provided search results, general characteristics of cold-adapted proteins suggest:

  • Higher structural flexibility, particularly around the active site

  • Reduced number of salt bridges and hydrogen bonds

  • Altered surface charge distribution

  • Modified amino acid composition with fewer proline and arginine residues

  • Potentially lower conformational stability but higher catalytic efficiency at low temperatures

Comparative analysis with mesophilic homologs (such as E. coli dsbB) would likely reveal these adaptive features that enable function in cold environments.

What are the most efficient cloning strategies for Psychrobacter arcticus dsbB?

Efficient cloning of P. arcticus dsbB can be achieved through:

  • PCR amplification using high-fidelity DNA polymerase with primers designed based on the P. arcticus genome sequence

  • Restriction enzyme-based cloning into shuttle vectors like pPS-NR or pPS-BR

  • Alternately, Gibson Assembly or other seamless cloning techniques for scarless fusion construction

For PCR amplification, reaction conditions should be optimized for GC-rich psychrophilic DNA templates. When designing constructs, including a C-terminal or N-terminal affinity tag (considering membrane topology) will facilitate subsequent purification while minimizing interference with protein function.

How can the expression of recombinant dsbB be optimized through genetic modifications?

Genetic modifications to optimize dsbB expression include:

  • Codon optimization based on the preferred codon usage of the expression host

  • Incorporation of strong, inducible promoters compatible with low-temperature expression

  • Addition of appropriate signal sequences for membrane localization

  • Engineering of fusion partners to enhance solubility or facilitate purification

  • Site-directed mutagenesis to enhance stability while maintaining catalytic activity

What methods are available for introducing recombinant plasmids into Psychrobacter arcticus?

Based on research with Psychrobacter strains, several methods have proven effective:

  • Triparental mating - Effective for introducing plasmids into various Psychrobacter strains

  • Biparental mating - Used successfully with E. coli as donor strain

  • Electroporation - Requires optimization of parameters for Psychrobacter

  • Chemical transformation - Protocols similar to those used for E. coli have been adapted

The efficiency varies based on the specific Psychrobacter strain. When using conjugation-based methods, the conjugal transfer system's compatibility is important - research has shown that seven plasmids from Psychrobacter sp. ANT_H3 could be mobilized by the RK2 conjugation system .

How does temperature affect the catalytic efficiency of Psychrobacter arcticus dsbB?

The catalytic efficiency of P. arcticus dsbB likely exhibits cold-adaptation features, including:

  • Higher catalytic rate (kcat) at low temperatures compared to mesophilic homologs

  • Lower activation energy for catalysis

  • Broader temperature activity profile with retained functionality at near-freezing temperatures

  • Potential trade-off with reduced thermostability at moderate temperatures

These properties reflect evolutionary adaptations to function efficiently in the Arctic habitat where Psychrobacter arcticus naturally occurs.

What role does dsbB play in stress tolerance mechanisms of Psychrobacter arcticus?

In Psychrobacter arcticus, dsbB likely contributes to stress tolerance through:

  • Ensuring proper folding of periplasmic and membrane proteins involved in stress response

  • Maintaining structural integrity of protective proteins during cold stress

  • Contributing to oxidative stress management by supporting the correct folding of periplasmic antioxidant enzymes

  • Potentially participating in cross-talk between oxidative folding and other stress response pathways

Psychrobacter species possess various genes conferring protection against environmental stressors including low temperature, increased UV radiation, oxidative stress, and osmotic pressure , and the dsbB protein may play a supporting role in several of these mechanisms.

How can recombinant Psychrobacter arcticus dsbB be utilized in biotechnological applications?

Potential biotechnological applications include:

  • Enhanced production of correctly folded, disulfide-containing recombinant proteins at low temperatures

  • Development of cold-active enzyme expression systems for industrial biocatalysis

  • Creation of biosensors that function in low-temperature environments

  • Improvement of heterologous protein expression in psychrophilic hosts

The cold-adapted nature of P. arcticus dsbB makes it particularly valuable for applications requiring disulfide bond formation at low temperatures, where mesophilic disulfide bond formation machinery may function suboptimally.

What are the main technical challenges in working with recombinant Psychrobacter arcticus dsbB?

Major technical challenges include:

  • Membrane protein expression and purification difficulties

  • Limited availability of optimized genetic tools for Psychrobacter compared to model organisms

  • Potential instability of cold-adapted proteins during purification at ambient temperatures

  • Difficulties in crystallization for structural studies due to inherent flexibility

  • Challenges in maintaining enzymatic activity during downstream processing

Addressing these challenges requires adapting standard protocols to accommodate the unique properties of psychrophilic proteins and developing specialized approaches for membrane protein work at low temperatures.

How might comparative genomics inform our understanding of dsbB evolution in psychrophilic bacteria?

Comparative genomic approaches could reveal:

  • Evolutionary adaptations in dsbB sequences across temperature gradients

  • Horizontal gene transfer events contributing to cold adaptation

  • Co-evolution of dsbB with other components of the disulfide formation pathway

  • Genus-specific variations in disulfide bond formation mechanisms

Analysis of plasmidomes across Psychrobacter species reveals significant diversity , suggesting that genome plasticity and horizontal gene transfer may have contributed to adaptive evolution of protein systems like dsbB.

What emerging technologies could advance research on Psychrobacter arcticus dsbB?

Promising technologies include:

  • Cryo-electron microscopy for structural determination of membrane proteins in native-like conditions

  • High-throughput directed evolution approaches for engineering enhanced variants

  • Single-molecule techniques to study real-time disulfide bond formation dynamics

  • CRISPR-Cas systems adapted for genome editing in Psychrobacter

  • Nanopore sequencing for rapid plasmidome characterization across Psychrobacter strains

These technologies could overcome current limitations in working with psychrophilic membrane proteins and accelerate research on cold-adapted disulfide bond formation systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.