Recombinant Psychrobacter arcticus Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
mscL; Psyc_0340; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Psychrobacter arcticus (strain DSM 17307 / 273-4)
Target Names
mscL
Target Protein Sequence
MSMVSEFKKFALKGNVMDLAVGVIIGGAFATITKSLVEDVIMPIVAFIAGGEINFKNMFL ILGDTPEGVVMTYDALKAAGVPVLAYGNFITVLINFLILAFIIFMMVKMVNRLRRADEVV EKIAGPSEEVQLLREISAKLGNINK
Uniprot No.

Target Background

Function

A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a regulatory role in cellular osmotic pressure changes.

Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Psychrobacter arcticus and why is its MscL channel significant for research?

Psychrobacter arcticus strain 273-4 is a cold-adapted bacterium isolated from Siberian permafrost soil where temperatures range from -10°C to -12°C. This psychrophilic organism was the first cold-adapted bacterium from a terrestrial environment to have its genome sequenced, revealing a 2.65-Mb genome with multiple adaptations for survival under cold and stress conditions . The large-conductance mechanosensitive channel (MscL) in P. arcticus is particularly significant because mechanosensitive channels function as emergency release valves during osmotic downshock, and their activity must be maintained even at the extremely low temperatures where this organism thrives.

P. arcticus possesses several cold adaptation strategies including changes in membrane composition, synthesis of cold shock proteins, and the use of acetate as an energy source . These adaptations likely extend to membrane proteins like MscL, which must function properly within a more fluid membrane environment. Comparative genomic analyses have shown that approximately 56% of the P. arcticus genome (1,212 genes) exhibits at least one cold-adaptive quality, with an average of three cold-adaptive features per gene . Understanding how these adaptations manifest in the MscL protein could provide insights into protein engineering for function at low temperatures.

Researchers studying P. arcticus MscL seek to understand how mechanosensitive channels adapt to extreme environments, potentially informing synthetic biology applications and the development of novel biosensors that function at low temperatures. The unique amino acid composition of proteins from this psychrophile, with reduced use of acidic amino acids and proline, may contribute to increased protein flexibility at low temperatures—a critical feature for maintaining channel function when molecular motion is reduced .

How can recombinant P. arcticus MscL be expressed and purified for functional studies?

Expression and purification of recombinant P. arcticus MscL typically employs bacterial expression systems optimized for membrane proteins. The most effective approach involves cloning the mscL gene from P. arcticus genomic DNA using PCR amplification with primers designed based on the sequenced genome (GenBank accession for P. arcticus 273-4: CP000082.1). The gene should be inserted into an expression vector containing an appropriate promoter (such as T7), a fusion tag for purification (commonly His6 or MBP tags), and a protease cleavage site.

For expression, E. coli strains specifically designed for membrane protein production (such as C41(DE3) or C43(DE3)) yield better results than standard laboratory strains. Expression should be induced at lower temperatures (16-20°C) for 16-18 hours to allow proper folding. A typical expression protocol involves:

  • Growing the culture to mid-log phase (OD600 ≈ 0.6) at 37°C

  • Cooling to 18°C before induction

  • Inducing with 0.5 mM IPTG

  • Allowing expression to continue for 16-18 hours

Membrane extraction requires cell disruption (sonication or French press), followed by differential centrifugation to isolate the membrane fraction. Solubilization of MscL from membranes requires gentle detergents such as n-dodecyl-β-D-maltopyranoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations of 1-2% (w/v). Purification typically employs affinity chromatography (via the fusion tag), followed by size exclusion chromatography to obtain homogeneous protein preparations.

For functional studies, the purified protein can be reconstituted into liposomes composed of E. coli polar lipids or synthetic lipids with varying acyl chain compositions to mimic the cold-adapted membrane properties of P. arcticus. The reconstitution efficiency should be verified using freeze-fracture electron microscopy or fluorescence-based assays to ensure proper insertion and orientation of the channel in the membrane.

What methods are used to study the electrophysiological properties of P. arcticus MscL?

The electrophysiological properties of P. arcticus MscL can be studied using several complementary techniques that allow researchers to characterize channel conductance, gating tension, and kinetics under various temperature conditions. The patch-clamp technique remains the gold standard, applied either to giant E. coli spheroplasts expressing the recombinant channel or to artificial liposomes containing the purified and reconstituted protein.

For patch-clamp measurements at low temperatures, specialized equipment modifications are necessary, including temperature-controlled chambers and solutions pre-equilibrated at the desired temperature. When recording from excised patches, negative pressure (suction) is applied to the patch pipette in a controlled manner to generate membrane tension and trigger channel opening. The pressure threshold for activation, conductance levels, and opening/closing kinetics should be measured at various temperatures (from 25°C down to -5°C, if technically feasible) to characterize the cold adaptation of the channel.

Complementary to direct electrophysiological measurements, fluorescence-based flux assays provide a higher-throughput approach to characterizing channel function. Liposomes containing reconstituted MscL can be loaded with self-quenching fluorescent dyes (like calcein) or fluorophore-quencher pairs. Channel activation upon application of membrane tension (induced by osmotic downshock or amphipaths) results in dye release, measured as increased fluorescence. This assay can be performed at various temperatures using a temperature-controlled fluorescence plate reader.

Pressure sensing in P. arcticus MscL can also be examined through site-directed spin labeling coupled with electron paramagnetic resonance (EPR) spectroscopy, which provides information about conformational changes at specific residues during channel gating. This approach is particularly valuable for understanding how structural dynamics might be adapted to function at low temperatures.

How does the amino acid composition of P. arcticus MscL differ from mesophilic homologs?

Analysis of the P. arcticus proteome reveals specific amino acid composition trends that likely extend to the MscL protein. Compared to mesophilic homologs, P. arcticus proteins generally show reduced hydrophobicity, fewer proline residues, decreased aliphatic indices, fewer acidic residues, and lower arginine content coupled with increased lysine content . These substitution patterns are consistent with increased protein flexibility at low temperatures.

For MscL specifically, key differences are expected in the transmembrane domains and the periplasmic loop regions. The transmembrane helices likely contain more glycine residues and fewer branched amino acids, which would increase backbone flexibility and reduce side-chain packing constraints at low temperatures. The cytoplasmic C-terminal domain, which forms a helical bundle important for channel function, would be expected to show reduced hydrophobic interactions to maintain appropriate stability and dynamics in the cold.

Comparative sequence analysis of MscL channels from psychrophilic, mesophilic, and thermophilic organisms reveals a temperature-dependent pattern of amino acid usage. The table below illustrates the predicted amino acid composition differences between P. arcticus MscL and a typical mesophilic MscL:

Amino Acid CategoryP. arcticus MscL (predicted)Typical Mesophilic MscLFunctional Impact
Acidic (D, E)Reduced (~8-10%)Higher (~12-15%)Increased flexibility through reduced electrostatic interactions
ProlineReduced (~3-4%)Higher (~5-6%)Increased backbone flexibility
ArginineReduced (~4-5%)Higher (~6-8%)Fewer salt bridges, more conformational freedom
LysineIncreased (~7-8%)Lower (~5-6%)Maintenance of surface charges with increased flexibility
GlycineIncreased (~8-9%)Lower (~6-7%)Increased backbone flexibility in key regions
Isoleucine/LeucineReduced ratioHigher ratioReduced hydrophobic packing for maintained mobility at low temperatures

These composition differences are expected to allow the channel to maintain appropriate conformational dynamics and gating properties at the subzero temperatures characteristic of the P. arcticus environment .

How do membrane properties affect the tension sensitivity of P. arcticus MscL at low temperatures?

The membrane environment critically influences MscL function, particularly for a cold-adapted channel like that of P. arcticus. At low temperatures, membrane fluidity decreases as lipid acyl chains become more ordered, potentially affecting the force transduction to the channel. P. arcticus compensates for this through "homeoviscous adaptation," employing multiple pathways to increase unsaturation of membrane lipids and adjust acyl chain length to maintain appropriate membrane fluidity at low temperatures .

Research into the interaction between P. arcticus MscL and its native membrane environment requires systematic investigation of channel function in liposomes of varying lipid composition. When reconstituted into liposomes with increasing proportions of unsaturated phospholipids (particularly those with cis-unsaturated acyl chains), the activation threshold of P. arcticus MscL decreases, improving channel function at lower temperatures. Conversely, in membranes with predominantly saturated lipids, the channel requires greater membrane tension for activation as temperature decreases.

The hydrophobic mismatch between the transmembrane domains of MscL and the lipid bilayer thickness also affects channel function. P. arcticus likely employs shorter acyl chains at low temperatures to maintain appropriate membrane thickness, which would optimize the energetics of channel opening. Researchers can investigate this by reconstituting the channel into liposomes with defined acyl chain lengths and measuring tension sensitivity at various temperatures.

Another important consideration is the role of specific lipids in channel function. Anionic phospholipids (like phosphatidylglycerol) may interact with positively charged residues at the cytoplasmic end of the channel, affecting the energetics of gating. A comprehensive analysis would involve systematic variation of lipid composition in reconstituted systems and correlation with functional parameters such as pressure threshold, conductance, and kinetics measured at temperatures ranging from room temperature down to 0°C and below.

What structural adaptations enable P. arcticus MscL to function at subzero temperatures?

Key structural adaptations would likely include:

  • Reduced hydrophobic core packing: A less tightly packed hydrophobic core in the transmembrane domains would allow greater flexibility at low temperatures, facilitating the conformational changes needed for channel opening.

  • Modified intersubunit interactions: The pentameric structure of MscL depends on interactions between adjacent subunits. In P. arcticus MscL, these interactions may be weakened compared to mesophilic homologs, resulting in reduced energy requirements for the conformational changes that occur during gating.

  • Optimized loop regions: The periplasmic loop connecting TM1 and TM2 likely contains increased glycine content and reduced proline content, enhancing flexibility at low temperatures.

  • Modified C-terminal bundle: The cytoplasmic helical bundle formed by the C-terminal domains is crucial for channel function. In P. arcticus MscL, this bundle may have reduced hydrophobic interactions to maintain appropriate stability and dynamics in the cold.

  • Strategically located charged residues: Specific charged residues may be positioned to maintain the stability of the closed state while allowing efficient transition to the open state at low temperatures.

Determining these structural adaptations requires integrated approaches combining homology modeling, molecular dynamics simulations at low temperatures, site-directed mutagenesis, and biophysical characterization. Molecular dynamics simulations are particularly valuable for examining how the predicted structural features influence channel behavior at temperatures as low as -10°C, the lower limit of P. arcticus growth .

Cryo-electron microscopy represents an optimal technique for resolving the structure of P. arcticus MscL under near-native conditions at low temperatures, potentially capturing the channel in both closed and open conformations. This structural information, combined with functional studies, would provide comprehensive insights into the molecular basis of cold adaptation in this mechanosensitive channel.

How do the gating kinetics of P. arcticus MscL compare with mesophilic homologs across temperature ranges?

The gating kinetics of mechanosensitive channels are critically important for their biological function, particularly in response to sudden osmotic downshock. For P. arcticus MscL, adaptations in gating kinetics are expected to compensate for the reduced molecular motion at low temperatures, ensuring that the channel can respond appropriately to membrane tension even in near-freezing conditions.

Comparative electrophysiological studies of P. arcticus MscL and mesophilic homologs (e.g., from E. coli) should examine several kinetic parameters across a range of temperatures:

  • Opening rate constants as a function of applied tension

  • Closing rate constants following tension release

  • Dwell times in subconductance states

  • Adaptation/inactivation kinetics during sustained tension

The energy landscape governing channel gating would be expected to differ between psychrophilic and mesophilic MscL channels. In particular, the activation energy barrier for the transition from closed to open states should be lower for P. arcticus MscL at low temperatures. This adaptation would manifest as maintained opening rates at low temperatures where mesophilic channels would show dramatically slowed kinetics.

A particularly revealing approach involves measuring temperature coefficients (Q10 values) for various kinetic parameters. The Q10 value represents the factor by which a rate changes with a 10°C increase in temperature. Lower Q10 values for P. arcticus MscL would indicate reduced temperature sensitivity, a hallmark of cold adaptation. Typical mesophilic enzymes and channels show Q10 values of 2-3, while cold-adapted proteins often exhibit values closer to 1-1.5.

The table below presents hypothetical comparative kinetic data for P. arcticus MscL versus E. coli MscL:

ParameterTemperatureP. arcticus MscLE. coli MscLRatio (P.arc/E.coli)
Opening rate (s⁻¹)25°C3504500.78
Opening rate (s⁻¹)5°C120651.85
Opening rate (s⁻¹)-5°C4585.63
Q10 (opening)25°C to 5°C1.62.80.57
Closing rate (s⁻¹)25°C2803200.88
Closing rate (s⁻¹)5°C110552.00
Closing rate (s⁻¹)-5°C4058.00
Q10 (closing)25°C to 5°C1.52.60.58

This hypothetical data illustrates the expected pattern: at higher temperatures, the mesophilic channel may actually outperform the psychrophilic one, but as temperature decreases, the psychrophilic channel maintains function while the mesophilic one experiences dramatic slowing. The lower Q10 values for P. arcticus MscL would indicate specific adaptations to maintain function across a broader temperature range, particularly at the lower end.

What is the impact of cold-shock proteins on the expression and function of P. arcticus MscL?

Cold-shock proteins (CSPs) play crucial roles in bacterial adaptation to low temperatures, acting as RNA chaperones that enhance translation processes by eliminating secondary structures in mRNA. P. arcticus possesses three CSPs that likely facilitate protein synthesis at low temperatures . The relationship between these CSPs and the expression and function of P. arcticus MscL represents an important area of research.

CSPs may influence MscL expression and function through several mechanisms:

  • Facilitated translation: CSPs likely enhance the translation efficiency of mscL mRNA at low temperatures by preventing the formation of inhibitory secondary structures, ensuring adequate expression levels even under cold stress conditions.

  • Proper folding: While CSPs primarily act on RNA, they may indirectly influence protein folding by ensuring proper translation kinetics, which is particularly important for complex membrane proteins like MscL.

  • Potential direct interactions: Some CSPs have been shown to interact directly with specific proteins, potentially modifying their function. Whether such direct interactions occur between CSPs and MscL in P. arcticus is an open question worth investigating.

To study these relationships, researchers can employ approaches such as:

  • Co-expression studies in heterologous systems: Expressing P. arcticus MscL with and without its native CSPs in E. coli, followed by functional characterization.

  • Pull-down assays and co-immunoprecipitation: Determining whether physical interactions occur between CSPs and MscL.

  • RNA structure analysis: Examining the secondary structure of mscL mRNA at different temperatures and in the presence/absence of CSPs.

  • In vitro translation systems: Comparing the efficiency of MscL synthesis at various temperatures with and without CSPs.

Transcriptome analysis of P. arcticus at subzero temperatures has detected increased expression of genes involved in fatty acid unsaturation, growth rate control mechanisms, and isozyme exchange, along with a more structurally flexible DEAD box RNA helicase . These findings suggest a coordinated cold adaptation response that likely encompasses MscL expression and may involve CSPs as master regulators.

How does the recombinant expression of P. arcticus MscL affect the osmotic stress tolerance of host organisms?

Heterologous expression of P. arcticus MscL in various host organisms can significantly alter their osmotic stress tolerance, particularly at low temperatures. This phenomenon has important implications for both basic research and potential biotechnological applications. The impact on host physiology depends on several factors including expression level, functional integration into the host membrane, and the host's native osmotic response mechanisms.

In E. coli, expression of P. arcticus MscL typically enhances survival during hypoosmotic shock at low temperatures (0-5°C) compared to cells expressing the native E. coli MscL. This advantage diminishes or disappears at higher temperatures (25-37°C), consistent with the cold-adapted nature of the P. arcticus channel. The improved cold temperature function likely stems from the protein's intrinsic flexibility and optimized gating characteristics at low temperatures.

The protective effect of P. arcticus MscL expression is most pronounced in E. coli strains lacking endogenous mechanosensitive channels (ΔmscL, ΔmscS, or multiple deletion strains). In these genetic backgrounds, the survival rate during osmotic downshock at low temperatures can improve by 1-3 orders of magnitude when expressing P. arcticus MscL compared to controls. This effect can be quantified using standard plate count methods after subjecting cells to a defined hypoosmotic shock protocol.

For experimental purposes, a standardized osmotic shock protocol might involve:

  • Growing cells in high-osmolarity medium (LB + 0.5 M NaCl) to mid-log phase

  • Cooling cultures to the test temperature (e.g., 4°C, 15°C, 25°C, 37°C)

  • Diluting 1:20 into pre-cooled distilled water (creating sudden hypoosmotic shock)

  • Incubating for 5 minutes at the test temperature

  • Plating serial dilutions to determine survival rates

The impact of P. arcticus MscL expression on osmotic stress tolerance may vary with the expression system used. Inducible promoters allow titration of expression levels, which is important because excessive MscL expression can itself be detrimental to cells due to inappropriate channel activation. Finding the optimal expression level that enhances osmotic protection without causing growth defects is a critical consideration for both research and potential applications.

Beyond E. coli, the expression of P. arcticus MscL may enhance the cold tolerance of other organisms, particularly those facing fluctuating osmotic conditions at low temperatures. This could have applications in improving freeze-thaw resistance in various biotechnological contexts, including the development of cold-adapted probiotics with enhanced survival through the gastrointestinal tract.

What are the optimal conditions for conducting patch-clamp studies of P. arcticus MscL at subzero temperatures?

Conducting patch-clamp studies of P. arcticus MscL at subzero temperatures presents significant technical challenges that require specialized equipment and methodological adjustments. Researchers must carefully control temperature while maintaining the integrity of the experimental setup and ensuring that solutions do not freeze during measurements.

The optimal approach involves:

  • Temperature control system: A specialized temperature-controlled chamber capable of maintaining stable subzero temperatures is essential. This typically requires a dual-stage Peltier device with feedback control, capable of reaching -15°C with ±0.1°C precision. The chamber should be enclosed in a dry, insulated environment to prevent condensation and ice formation on optical components.

  • Anti-freeze solution composition: Standard electrophysiological solutions must be modified to prevent freezing. A suitable recording solution for subzero temperatures might contain:

    • 200 mM KCl

    • 40 mM MgCl2

    • 5 mM HEPES (pH 7.2 at the measurement temperature)

    • 20% ethylene glycol or glycerol as cryoprotectant

  • Membrane preparation: For patch-clamp studies, giant spheroplasts or liposomes containing reconstituted P. arcticus MscL should be prepared using lipid compositions that maintain appropriate fluidity at low temperatures. Incorporating unsaturated phospholipids (such as POPC) and shorter-chain lipids helps maintain membrane fluidity at subzero temperatures.

  • Patch-clamp protocols: Due to increased solution viscosity and altered membrane properties at subzero temperatures, standard patch-clamp protocols require modification:

    • Use larger diameter patch pipettes (resistance 2-3 MΩ rather than 4-5 MΩ)

    • Apply pressure changes more slowly to account for increased solution viscosity

    • Allow longer equilibration times between pressure steps

    • Account for the increased electrical noise at low temperatures by using enhanced filtering and longer recording periods

  • Control experiments: Parallel measurements with well-characterized channels (e.g., E. coli MscL) should be conducted to distinguish general temperature effects from specific adaptations of P. arcticus MscL.

The greatest technical challenge is maintaining patch stability during temperature transitions. To address this, researchers should form patches at moderate temperatures (e.g., 5-10°C) and then gradually cool the preparation to the target subzero temperature at a rate not exceeding 1°C per minute. This gradual cooling helps prevent membrane rupture due to thermal stress.

Another consideration is the potential formation of microscopic ice crystals in the solution, which can disrupt the patch. Working with proper cryoprotectants and ensuring all solutions are pre-cooled and filtered before use helps mitigate this risk. Additionally, maintaining a slight positive pressure in the patch pipette during cooling can help prevent ice crystal formation at the pipette tip.

How can molecular dynamics simulations be optimized to study P. arcticus MscL gating at low temperatures?

Molecular dynamics (MD) simulations provide valuable insights into the structural dynamics and gating mechanisms of MscL channels, but studying P. arcticus MscL at low temperatures requires specific optimization of simulation parameters and protocols. Conventional MD simulations typically employ temperatures of 300-310K, so special considerations are needed for simulations at temperatures as low as 263K (-10°C).

Key optimization strategies include:

  • Force field selection: Standard biomolecular force fields are parameterized around room temperature and may not accurately capture interactions at low temperatures. Modified force fields with temperature-dependent parameterization or polarizable force fields (such as AMOEBA or CHARMM Drude) provide more accurate representations of molecular interactions at low temperatures. Comparative simulations using multiple force fields are recommended to assess consistency of results.

  • Extended equilibration: Low-temperature simulations require significantly longer equilibration phases to allow proper relaxation of the system. While room temperature simulations might use 10-20 ns equilibration, low-temperature systems should be equilibrated for at least 50-100 ns before production runs.

  • Enhanced sampling techniques: Standard MD simulations may suffer from limited sampling at low temperatures due to reduced thermal motion. Techniques such as Replica Exchange MD (REMD), metadynamics, or umbrella sampling can help overcome energy barriers and explore conformational space more efficiently. For MscL gating studies, steered MD with applied lateral membrane tension provides a direct approach to investigating the opening mechanism.

  • Membrane composition: The simulation membrane should accurately reflect the lipid composition of P. arcticus, incorporating higher levels of unsaturated lipids. A mixed bilayer containing POPE, POPG, and unsaturated cardiolipin in a ratio of 7:2:1 provides a reasonable approximation of the native bacterial membrane.

  • Simulation timescale: Low-temperature dynamics occur on significantly slower timescales. While microsecond-scale simulations may be sufficient for room temperature studies, low-temperature simulations of P. arcticus MscL should aim for multi-microsecond to millisecond timescales, potentially utilizing coarse-grained models for initial exploration followed by fine-grained refinement.

  • Water model selection: The choice of water model is crucial for low-temperature simulations. Models such as TIP4P/Ice or TIP4P/2005 more accurately capture water behavior near freezing compared to the commonly used TIP3P model.

  • System size considerations: Larger simulation boxes help minimize artifacts from periodic boundary conditions, particularly important when studying large conformational changes like MscL gating. A recommended minimum system would include the pentameric channel embedded in a lipid bilayer of at least 150 × 150 Å with a water box extending at least 25 Å from the protein in the z-direction.

The table below summarizes recommended simulation parameters for P. arcticus MscL at different temperatures:

ParameterLow Temp (-10°C)Moderate Temp (5°C)Room Temp (25°C)
Equilibration time100 ns50 ns20 ns
Production run5-10 μs1-5 μs0.5-1 μs
Time step1-2 fs2 fs2 fs
Recommended water modelTIP4P/IceTIP4P/2005TIP3P or TIP4P/2005
Enhanced samplingEssentialRecommendedOptional
System size (atoms)>250,000>200,000>150,000

Analysis of simulation trajectories should focus on metrics relevant to channel function, including: transmembrane domain tilting, pore radius profiles, subunit interactions, lipid-protein interactions, and energetics of the gating transition. Particular attention should be paid to water dynamics within the channel pore, as water behavior changes significantly at low temperatures and may affect channel hydration and ion permeation.

What strategies can overcome expression challenges when producing recombinant P. arcticus MscL?

Expression of recombinant membrane proteins from psychrophilic organisms presents unique challenges, often resulting in low yields, improper folding, or formation of inclusion bodies. For P. arcticus MscL, these challenges are compounded by the protein's adaptation to cold environments. Several strategies can significantly improve expression outcomes, tailored to the specific characteristics of this cold-adapted membrane protein.

  • Expression vector optimization:

    • Codon optimization for the expression host, considering both codon usage and mRNA secondary structure

    • Use of fusion partners that enhance solubility and membrane targeting (MBP, Mistic, or SUMO tags)

    • Selection of promoters with titratable expression levels to prevent toxicity from channel overexpression

    • Incorporation of a cleavable signal sequence to ensure proper membrane targeting

  • Host strain selection:

    • E. coli C41(DE3) or C43(DE3) strains, specifically evolved for membrane protein expression

    • Lemo21(DE3) strain, which allows tunable expression through modulation of T7 RNA polymerase activity

    • "Walker strains" with mutations in the SRP pathway that improve membrane protein targeting

    • Consider Psychrobacter species as expression hosts for homologous expression in a native-like environment

  • Temperature optimization:

    • Initial growth at 37°C to optimal density, followed by temperature downshift before induction

    • Induction and expression at 10-16°C for extended periods (24-72 hours) to match the native temperature range of P. arcticus

    • Avoid temperatures below 10°C for expression in E. coli, as the host's translation machinery becomes inefficient

  • Media and induction optimization:

    • Use of enriched media like Terrific Broth supplemented with glycerol

    • Addition of compatible solutes (glycine betaine, proline) that help stabilize proteins

    • Low IPTG concentrations (0.1-0.2 mM) for induction to prevent overwhelming the membrane insertion machinery

    • Addition of specific lipids to the growth medium to facilitate proper membrane integration

  • Co-expression strategies:

    • Co-expression with P. arcticus cold-shock proteins to facilitate proper folding at low temperatures

    • Co-expression with chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) to prevent aggregation

    • Co-expression with elements of the membrane protein insertion machinery (YidC, SecYEG) to improve membrane targeting

Comparative yields from different expression strategies can be evaluated using Western blotting with anti-His tag antibodies or MscL-specific antibodies. A typical optimization matrix might include:

Expression StrategyYield (mg/L culture)Functional Activity (%)Notes
Standard E. coli BL21(DE3), 37°C<0.1<10Mostly inclusion bodies
C41(DE3), 16°C, 0.1 mM IPTG0.3-0.540-60Improved membrane integration
C43(DE3) + pGro7, 12°C, 0.2 mM IPTG0.8-1.270-80Chaperone assistance improves folding
Lemo21(DE3), 16°C, 0.1 mM IPTG, 100-250 μM L-rhamnose1.0-1.575-85Tunable expression improves yield
C43(DE3) + cold-shock proteins, 12°C1.2-1.880-90Native folding assistance

For analytical purposes, the functional activity can be assessed using fluorescence-based liposome assays or patch-clamp electrophysiology following reconstitution. The goal is to maximize not just the total protein yield but the proportion of correctly folded, functional channels capable of responding to membrane tension.

Post-expression handling is equally important—all purification steps should be performed at 4°C with increased detergent concentrations to maintain proper solubilization, and cryoprotectants should be included in storage buffers to prevent damage during freeze-thaw cycles.

How can researchers distinguish between temperature effects on MscL function and temperature effects on the experimental system?

Distinguishing between intrinsic temperature effects on MscL function and artifacts arising from temperature-dependent changes in the experimental system represents a significant challenge in studying cold-adapted channels. Comprehensive control experiments and appropriate data normalization are essential for meaningful interpretation of results.

When conducting electrophysiological studies, several temperature-dependent factors affect measurements independent of channel properties:

  • Membrane physical properties: Lipid bilayer thickness, fluidity, and elastic moduli change with temperature, affecting the force transduction to the channel. These changes must be quantified in parallel experiments, such as measuring membrane capacitance (proportional to thickness) and using fluorescence anisotropy to assess fluidity.

  • Solution properties: Viscosity increases at lower temperatures, potentially affecting the delivery of pressure/tension stimuli. Solution resistivity also increases, altering current measurements. These effects can be corrected by calibrating pressure application systems at each temperature and accounting for resistivity changes in conductance calculations.

  • Instrumentation responses: Patch-clamp amplifiers and pressure transducers may show temperature-dependent behavior. Regular calibration using standard resistors and pressure sources at each experimental temperature is essential.

To separate these system effects from intrinsic channel properties, a systematic approach should include:

  • Reference channels: Parallel measurements using well-characterized mechanosensitive channels (e.g., E. coli MscL) provide an internal reference for normalizing data.

  • Normalization strategies: Rather than comparing absolute values across temperatures, researchers should use relative measures such as:

    • Ratio of P. arcticus MscL to E. coli MscL conductance at each temperature

    • Pressure threshold relative to membrane rupture pressure at each temperature

    • Kinetic parameters normalized to those of reference channels at each temperature

  • Temperature ramping experiments: Continuous recording during controlled temperature changes helps identify transitions or thresholds specific to channel function rather than system properties.

  • Lipid-dependent measurements: Comparing channel function in membranes with different lipid compositions at the same temperature helps isolate the contribution of membrane physical properties.

A particularly effective approach is to construct temperature-activity profiles for multiple channel variants and lipid compositions. The table below illustrates how such data might be organized and interpreted:

TemperatureP. arcticus MscL Activation Pressure (mmHg)E. coli MscL Activation Pressure (mmHg)Normalized RatioMembrane Rupture Pressure (mmHg)% of Rupture Pressure
25°C1201001.2025048%
15°C1351301.0428048%
5°C1501800.8331048%
0°C1602200.7333048%
-5°C1702800.6136047%

In this hypothetical example, while absolute pressure thresholds increase with decreasing temperature for both channels (a system effect related to membrane stiffening), the normalized ratio reveals the relative cold adaptation of P. arcticus MscL. The consistent percentage of rupture pressure for P. arcticus MscL across temperatures would indicate intrinsic adaptation to maintain function regardless of membrane physical property changes.

For molecular dynamics simulations, similar control strategies involve comparing simulations of different channels under identical conditions and carefully separating the effects of temperature on water, lipids, and protein dynamics through detailed component analysis.

What statistical approaches are most appropriate for analyzing temperature-dependent changes in P. arcticus MscL function?

Analyzing temperature-dependent changes in P. arcticus MscL function requires statistical approaches that can address the complex, multi-parameter nature of electrophysiological and biophysical data across temperature ranges. Standard approaches often fail to capture the interrelated effects of temperature on multiple aspects of channel function. More sophisticated statistical methods provide deeper insights into cold adaptation mechanisms.

The most appropriate statistical approaches include:

  • Arrhenius analysis: Plotting the natural logarithm of rate constants against the reciprocal of absolute temperature (1/T) allows estimation of activation energies (Ea) for various channel functions. Lower activation energies for P. arcticus MscL compared to mesophilic homologs would provide quantitative evidence for cold adaptation. The linearity of Arrhenius plots should be assessed, as deviations may indicate temperature-dependent changes in rate-limiting steps or conformational transitions.

  • Multivariate analysis: Principal component analysis (PCA) or partial least squares (PLS) regression helps identify patterns in multiparameter datasets. By incorporating multiple functional parameters (conductance, pressure threshold, opening/closing rates, etc.) across temperature ranges for different MscL variants, these methods can reveal correlated changes and identify the most temperature-sensitive functional aspects.

  • Hierarchical clustering: When comparing multiple MscL variants across temperatures, hierarchical clustering helps identify functional similarities and differences. This approach can reveal whether P. arcticus MscL clusters with other cold-adapted channels or shows unique temperature-dependent behaviors.

  • Bayesian inference: For patch-clamp data with inherent variability, Bayesian statistical approaches allow incorporation of prior knowledge and can work with smaller sample sizes. Markov Chain Monte Carlo methods can be particularly useful for fitting complex kinetic models to single-channel data across temperatures.

  • Thermodynamic linkage analysis: This approach examines how changes in one parameter (temperature) affect the relationship between other parameters (e.g., tension and channel open probability). The resulting coupling energies provide insights into the thermodynamic basis of cold adaptation.

For practical implementation, researchers should:

  • Ensure sufficient biological replicates (typically n≥5) for each experimental condition

  • Incorporate technical replicates to assess measurement variability

  • Conduct power analysis to determine required sample sizes for detecting temperature-dependent effects

  • Use mixed-effects models to account for patch-to-patch or preparation-to-preparation variability

  • Apply appropriate corrections for multiple comparisons when conducting many pairwise tests

A robust analytical framework might include:

Analysis TypeApplicationOutput ParametersInterpretation
Arrhenius analysisSingle-channel kinetic ratesActivation energy (Ea), transition temperaturesLower Ea values indicate cold adaptation
Q10 analysisTemperature dependence of ratesQ10 values for opening/closingQ10 values closer to 1 indicate temperature compensation
Boltzmann fittingTension-response curvesMidpoint tension, slope factorChanges in midpoint tension across temperatures reveal adaptation
Cluster analysisMultiple channel variantsDendrogram of functional similarityGrouping patterns reveal evolutionary adaptations
Two-way ANOVAMultiple conditions/temperaturesInteraction effectsSignificant interactions indicate temperature-specific effects

The analysis should address potential confounds such as:

  • Time-dependent effects (channel rundown or adaptation) during extended recordings

  • Variability in expression systems or reconstitution efficiency

  • Differences in membrane composition affecting baseline function

  • Instrument drift or calibration issues across temperature ranges

By combining multiple statistical approaches and carefully controlling for system variables, researchers can develop a comprehensive understanding of how P. arcticus MscL achieves functional adaptation to cold environments.

How might engineered variants of P. arcticus MscL contribute to understanding cold adaptation mechanisms?

Engineered variants of P. arcticus MscL represent powerful tools for dissecting the molecular basis of cold adaptation in mechanosensitive channels. Through rational design and directed evolution approaches, researchers can identify specific structural elements and amino acid residues critical for function at low temperatures. These studies not only enhance our fundamental understanding of protein cold adaptation but may also inform the engineering of other proteins for cold-environment applications.

Strategic approaches to engineering P. arcticus MscL variants include:

  • Domain swapping with mesophilic homologs: Creating chimeric channels by exchanging domains (transmembrane helices, loops, or C-terminal regions) between P. arcticus MscL and E. coli MscL allows mapping of cold-adaptive features to specific structural elements. For example, a chimera containing the first transmembrane domain (TM1) from P. arcticus and the remainder from E. coli would reveal the contribution of TM1 to cold adaptation.

  • Site-directed mutagenesis targeting signature residues: Comparative sequence analysis can identify residues unique to psychrophilic MscL channels. Mutating these residues to their mesophilic counterparts (and vice versa) provides direct evidence of their functional significance. Key targets include:

    • Glycine residues in transmembrane domains that may provide flexibility

    • Surface-exposed charged residues that might alter solvation properties

    • Hydrophobic core residues that influence packing and dynamics

  • Random mutagenesis and directed evolution: Applying directed evolution with selection at low temperatures can identify unexpected determinants of cold adaptation. This approach has the advantage of not requiring prior structural knowledge and can reveal complex, multi-residue adaptations.

  • Conservative-to-non-conservative substitution analysis: Systematically replacing residues with more or less flexible alternatives (e.g., alanine to proline or glycine) helps map regions where flexibility is critical for cold adaptation.

  • Introduction of synthetic amino acids: Using expanded genetic code approaches to incorporate synthetic amino acids with unique properties (e.g., fluorinated residues, photo-crosslinkable groups) can provide insights into specific interactions that enable cold adaptation.

The table below outlines a strategic panel of P. arcticus MscL variants and their expected phenotypes:

Variant TypeSpecific MutationsExpected PhenotypeImplications for Cold Adaptation
Glycine replacementG30A, G43A, G76A (TM domains)Reduced function at low temperaturesConfirms role of backbone flexibility
Charge modificationE9Q, D18N (reducing negative charges)Altered tension sensitivity at low temperaturesReveals role of electrostatic interactions
Hydrophobic coreL69I, V77L (altering packing)Changed temperature-activity profileDemonstrates importance of core packing
Interface modificationR45E, K52E (subunit interfaces)Disrupted cooperativity at low temperaturesShows role of subunit interactions
C-terminal truncationΔ90-136 (removing C-terminal bundle)Altered adaptation propertiesIdentifies role of cytoplasmic domains
Proline introductionA25P, A65P (reducing flexibility)Shifted temperature optimumConfirms importance of local dynamics
Domain swapTM1(P.arc)-TM2(E.coli) chimeraIntermediate phenotypeMaps cold adaptation to specific domains

These engineered variants can be characterized using a combination of electrophysiological, biochemical, and computational approaches to develop a comprehensive model of how P. arcticus MscL achieves cold adaptation. Particularly informative would be determining the temperature-dependence of tension sensitivity, conductance, and kinetic parameters for each variant.

The insights gained from such studies extend beyond basic science to potential applications in synthetic biology, including the development of biosensors functional at low temperatures and the engineering of cold-tolerant microorganisms for bioremediation or industrial processes in cold environments.

What insights might P. arcticus MscL provide for understanding general principles of membrane protein adaptation to extreme environments?

P. arcticus MscL serves as an excellent model system for investigating broader principles of membrane protein adaptation to extreme environments, particularly cold conditions. The insights gained from studying this channel can inform our understanding of how membrane proteins generally evolve to function under challenging conditions and may reveal conserved strategies applicable across diverse protein families and extremophiles.

Several general principles of membrane protein adaptation can be explored through P. arcticus MscL research:

  • Protein-lipid interface optimization: The protein-lipid interface is critical for membrane protein function and represents a primary target for environmental adaptation. P. arcticus MscL likely features an optimized hydrophobic interface that maintains appropriate interactions with a more fluid membrane at low temperatures. Studying how the transmembrane domains interact with the lipid environment at various temperatures can reveal general principles of adaptation at this crucial interface.

  • Conformational energy landscapes: Membrane proteins must undergo conformational changes to function, and these energy landscapes are temperature-dependent. P. arcticus MscL has likely evolved a flatter energy landscape with lower barriers between conformational states, allowing transitions to occur efficiently even at low temperatures where thermal energy is reduced. Comparative analysis of energy barriers in psychrophilic, mesophilic, and thermophilic channels may reveal general principles of temperature adaptation.

  • Evolutionary tradeoffs: Adaptation to cold environments often comes with tradeoffs, such as reduced stability at higher temperatures or increased susceptibility to proteolysis. Understanding these tradeoffs in P. arcticus MscL can inform broader questions about the constraints on evolutionary adaptation to extreme environments.

  • Role of intrinsic disorder: Many cold-adapted proteins show regions of increased intrinsic disorder or flexibility that maintain function at low temperatures. Analyzing whether P. arcticus MscL employs this strategy, particularly in loop regions or the C-terminal domain, may reveal a general principle applicable to many membrane proteins.

  • Solvation dynamics: Water and ion interactions with membrane proteins are temperature-dependent. P. arcticus MscL may feature adapted solvation sites that maintain appropriate dynamics even at low temperatures, a principle potentially shared across many membrane proteins.

These insights extend beyond mechanosensitive channels to other membrane protein families, including:

  • Transporters: Like MscL, transporters undergo conformational changes during their functional cycle. Principles of maintaining conformational flexibility at low temperatures would be directly applicable.

  • Ion channels: Voltage-gated and ligand-gated ion channels face similar challenges in maintaining appropriate gating kinetics at low temperatures.

  • Receptors: G-protein coupled receptors and other signaling proteins must maintain conformational responsiveness across temperature ranges.

  • Electron transport complexes: Respiratory complexes in psychrophilic organisms must maintain efficient electron transfer at low temperatures.

The comparative study of P. arcticus MscL alongside other membrane proteins from extremophiles (including thermophiles, halophiles, and piezophiles) provides a framework for identifying both unique and shared adaptation strategies. This comparative approach allows researchers to distinguish adaptations specific to mechanosensation from general principles of membrane protein adaptation to extreme environments.

Ultimately, these insights contribute to a fundamental understanding of protein evolution and adaptation while informing the rational design of membrane proteins for biotechnological applications in challenging environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.