Recombinant Psychrobacter arcticus Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant MsbA from P. arcticus is produced in E. coli with an N-terminal His tag for purification . Key specifications include:

ParameterDescription
SpeciesPsychrobacter arcticus
Expression SystemE. coli
TagN-terminal His tag
Protein LengthFull-length (1–598 amino acids)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) at -80°C
ReconstitutionSterile water with optional glycerol (5–50%) for long-term stability

The amino acid sequence includes conserved ATP-binding motifs and transmembrane domains critical for its transport function .

Functional Role in Lipid A Transport

MsbA is indispensable for LPS assembly and bacterial viability:

  • Substrate Specificity: Primarily transports lipid A but also interacts with hydrophobic drugs, linking it to multidrug resistance .

  • Cold Adaptation: In P. arcticus, lipid A modifications (e.g., shorter acyl chains) enhance membrane fluidity at subzero temperatures, a trait critical for survival in permafrost .

4.1. Mechanistic Studies

  • Cryo-EM structures (2024) demonstrate MsbA’s conformational spectrum depends on membrane mimics, with functional flexibility retained only in specific environments (e.g., nanodiscs) .

  • ATPase Activity: MsbA hydrolyzes ATP to energize lipid A transport, with activity modulated by lipid environment and substrate binding .

4.2. Biological Relevance

  • Permafrost Adaptation: P. arcticus lipid A lacks secondary acyl chains, reducing LPS rigidity and enabling growth at -6°C .

  • Biofilm Formation: While not directly linked to MsbA, P. arcticus biofilms rely on surface adhesins like Cat1, suggesting coordinated membrane remodeling .

Applications

  • Drug Development: MsbA is a target for antimicrobials due to its role in LPS biogenesis and multidrug efflux .

  • Biochemical Tools: Recombinant MsbA is used in ELISA kits (e.g., CSB-CF676796PAaV) for antibody development and protein interaction studies .

Future Directions

  • Structural Dynamics: Resolving intermediate states during ATP hydrolysis could inform inhibitor design .

  • Environmental Adaptation: Studying MsbA in psychrophilic bacteria may yield insights into membrane protein evolution under extreme conditions .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a particular tag type in mind, please inform us, and we will prioritize developing it according to your specification.
Synonyms
msbA; Psyc_1316; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-595
Protein Length
full length protein
Species
Psychrobacter arcticus (strain DSM 17307 / 273-4)
Target Names
msbA
Target Protein Sequence
MSQAYQPDSTKTSAKKSSAVTLNPPKRKTLMRLLAYLKPYWWAILLTITGFAINAGTEIW IAKLLQYITDAINQNDQSKQGLFPFIIVMLFFVRGVGSFLGNYYTALVSRNLVYELRVEV FNKLLRLPSSFYLANPAGTISSKLIFDVEQVTAASTDSLKTLLRDGLTVIALMGFLLYSN WRLTLILFVVLPPILWIIRVASKRYLKLSKGIQATMGGVSHITNEVINGYQVVKNYGGQA YESKRFDEVSKKNLRQGMKIVVTNSINTPAVQLLMAVAMAVVVWLALRPAVIDDISAGQF ISYIAAAGLLSKPVRSLTDVNQQLQRGIAAGESIFALLDEPEEEDTGVLSPALVGEIKLD NISLVYPDSTVALHDFNLDIRAGETVALVGRSGAGKSSLVNLLTRTLSTSSGQITLDGMP IEDIKLESLRAQIAMVNQQVVLFNTTVFNNIAYGSLAHKTPAEVEQAAKDAFAHDFIMQM PNGYQSEIGAEGLQLSGGQRQRLSIARALLKDAPILILDEATSALDNESEYYIQKALDNI MRNRTTLVIAHRLTTIESADRIAVLDGGRIVELGTHAELMQLHGHYAQMYARDFE
Uniprot No.

Target Background

Function
This protein is involved in lipopolysaccharide (LPS) biosynthesis. It translocates lipid A-core from the inner to the outer leaflet of the inner membrane. Its transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Psychrobacter arcticus msbA protein and what is its biological function?

The msbA protein in Psychrobacter arcticus is a Lipid A export ATP-binding/permease protein classified under EC 3.6.3.- (ATP-dependent transporters). It functions as a membrane transporter, specifically involved in the export of lipid A, which is a critical component of the bacterial outer membrane lipopolysaccharide (LPS). The protein contains 595 amino acids and is encoded by the msbA gene (locus name: Psyc_1316) in P. arcticus strain DSM 17307 / 273-4 .

The protein plays a crucial role in cell membrane integrity and function, particularly in extremophiles like P. arcticus that must maintain membrane fluidity at very low temperatures. The amino acid sequence contains transmembrane domains typical of ABC transporters, along with ATP-binding regions that provide energy for the transport process. This protein is part of the adaptive machinery that allows P. arcticus to survive in permafrost conditions for over 20,000 years .

How is recombinant P. arcticus msbA protein typically expressed and purified?

Recombinant P. arcticus msbA protein is typically expressed in E. coli expression systems, similar to other membrane proteins with transport functions. While the specific expression system for P. arcticus msbA is not directly detailed in the provided sources, comparable proteins such as Yersinia pseudotuberculosis msbA use E. coli expression systems with N-terminal His-tagging for purification purposes .

The methodology involves:

  • Gene cloning into an appropriate expression vector

  • Transformation into an E. coli expression strain

  • Induction of protein expression (typically using IPTG for T7 promoter systems)

  • Cell lysis and membrane protein extraction using detergents

  • Affinity chromatography purification (using His-tag or other fusion tags)

  • Buffer exchange to stabilize the protein (often containing glycerol)

The resulting purified protein is typically stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for long-term storage . For functional studies, the protein may need to be reconstituted into artificial membrane systems such as liposomes or nanodiscs.

What are the optimal storage conditions for recombinant P. arcticus msbA protein?

Based on available data, recombinant P. arcticus msbA protein should be stored following these guidelines:

  • Temperature: Store at -20°C for regular use, or -80°C for extended storage periods

  • Buffer composition: Tris-based buffer containing 50% glycerol, optimized for protein stability

  • Aliquoting: Working aliquots should be prepared to avoid repeated freeze-thaw cycles

  • Short-term storage: Working aliquots may be stored at 4°C for up to one week

The high glycerol concentration (50%) is particularly important for maintaining protein stability during freezing, as it prevents ice crystal formation that could damage the protein structure. For similar membrane proteins, buffer optimization might include the addition of specific detergents to maintain the protein in a soluble state while preserving its native conformation and functionality .

How does the structure of P. arcticus msbA relate to its function in cold adaptation?

The structure-function relationship of P. arcticus msbA represents a critical aspect of cold adaptation mechanisms. While no crystal structure is specifically available for P. arcticus msbA in the provided sources, analysis of its amino acid sequence reveals features consistent with cold adaptation:

The protein contains 595 amino acids with multiple transmembrane domains characteristic of ABC transporters . Comparative analysis of cold-adapted proteins in P. arcticus has shown significant shifts in amino acid usage to include residues that increase protein flexibility at low temperatures . This flexibility is crucial for maintaining catalytic activity when thermal energy is reduced at near-freezing temperatures.

Key structural features likely include:

  • Reduced hydrophobic core packing to maintain flexibility at low temperatures

  • Increased proportion of glycine residues in loop regions

  • Fewer proline residues in loop structures to maintain flexibility

  • More charged residues on the protein surface to maintain solubility in cold conditions

These structural adaptations allow the msbA protein to perform its ATP-dependent transport functions even at temperatures as low as -10°C, consistent with P. arcticus' growth range (-10°C to 28°C) . The protein likely works in concert with changes in membrane lipid composition, as P. arcticus is known to decrease fatty acid saturation at low temperatures to maintain membrane fluidity .

What experimental approaches are recommended for studying the biochemical properties of P. arcticus msbA?

For comprehensive characterization of P. arcticus msbA biochemical properties, researchers should implement a multi-method approach:

ATP Hydrolysis Assays

  • Malachite green phosphate assay to measure ATPase activity at different temperatures (4°C to 22°C)

  • Determination of kinetic parameters (Km, Vmax) as a function of temperature

  • Dependence on divalent cations (Mg2+, Mn2+)

Lipid Transport Assays

  • Reconstitution into proteoliposomes with fluorescently labeled lipid substrates

  • Transport measurements using stopped-flow techniques adapted for low-temperature studies

  • Effect of temperature on transport rate and substrate specificity

Protein Stability Studies

  • Differential scanning calorimetry (DSC) to determine thermal stability profiles

  • Circular dichroism (CD) spectroscopy at various temperatures to monitor secondary structure changes

  • Limited proteolysis experiments at different temperatures to identify flexible regions

Functional Complementation

  • Heterologous expression in msbA-deficient E. coli strains

  • Growth phenotype analysis at different temperatures

  • Membrane integrity assessments using fluorescent dyes

These experimental approaches should be performed across a temperature range of -6°C to 22°C to capture the functional profile relevant to P. arcticus' natural environment and laboratory growth conditions . Special attention should be paid to buffer composition, as cold-adapted enzymes often display different ionic requirements than their mesophilic counterparts.

How does expression of the msbA gene change in P. arcticus grown at different temperatures?

Transcriptomic analysis of P. arcticus reveals temperature-dependent regulation of gene expression, though the msbA gene specifically was not highlighted in the provided sources. Based on the general pattern observed in P. arcticus transcriptome studies, we can infer the likely expression pattern:

P. arcticus exhibits distinct transcriptional states at different temperatures, with a resource efficiency response induced at temperatures below 4°C . At lower temperatures (0°C and -6°C), genes involved in membrane transport tend to show altered expression patterns compared to growth at optimal temperature (17°C) .

While specific msbA expression data is not provided, the following patterns are likely based on similar membrane proteins:

  • Possible upregulation at low temperatures to maintain sufficient transport activity when enzyme kinetics are slower

  • Potential co-regulation with genes involved in lipid metabolism, as membrane composition changes are a key cold adaptation mechanism

  • Likely coordinated expression with other genes involved in cell envelope maintenance

These expression changes would be consistent with the observed adaptation strategy of P. arcticus, which prioritizes resource efficiency at low temperatures rather than expression of cold shock proteins or chaperones . Future research specifically examining msbA expression across temperature gradients would provide valuable insights into how this critical transport function is maintained in permafrost conditions.

What protocols are recommended for creating knockout mutants of msbA in P. arcticus for functional studies?

Creating knockout mutants in P. arcticus requires specific protocols adapted for this psychrophilic organism. Based on successful mutagenesis approaches used for other P. arcticus genes, the following methodology is recommended:

  • Vector Selection: Use the pJK100 suicide vector system, which has been successfully employed for creating knockout mutants in P. arcticus .

  • Construct Design:

    • Amplify upstream and downstream flanking regions of the msbA gene

    • For upstream regions, use primers with BglII and NotI restriction sites

    • For downstream regions, use primers with SacII and SacI restriction sites

    • Ligate these regions into the pJK100 vector using T4 DNA ligase

  • Transformation Protocol:

    • Transform the construct into E. coli WM3064 by electroporation

    • Grow P. arcticus cultures in Luria-Bertani (LB) broth at 22°C for 36 hours

    • Grow E. coli WM3064 containing the suicide vector at 37°C in LB broth supplemented with:

      • 25 μg/ml kanamycin

      • 20 μg/ml tetracycline

      • 100 μg/ml diaminopimelic acid

  • Conjugation:

    • Combine E. coli donor and P. arcticus using a ratio of 200 μl E. coli to 200-800 μl P. arcticus

    • Follow established conjugation protocols for P. arcticus

  • Mutant Selection and Verification:

    • Select on appropriate antibiotic-containing media

    • Verify gene deletion using PCR and sequencing

    • Confirm the absence of msbA protein expression via Western blotting

It's important to note that complete deletion of msbA may be lethal if the protein is essential, as is the case in many bacteria. Therefore, conditional knockout strategies or partial deletions targeting specific domains might be necessary alternatives.

What approaches should be used to study the role of P. arcticus msbA in biofilm formation?

P. arcticus has been shown to form biofilms under laboratory conditions at temperatures from 4°C to 22°C when acetate is used as the carbon source and with 1-7% sea salt . To investigate the specific role of msbA in biofilm formation, a comprehensive research approach is recommended:

Static Microtiter Plate Assays

  • Compare wild-type and msbA mutant (if viable) or knockdown strains

  • Perform assays across temperature range (4°C, 0°C, -6°C, 17°C, 22°C)

  • Quantify biofilm formation using crystal violet staining

  • Conduct time-course studies to evaluate attachment kinetics

Flow Cell Experiments

  • Grow biofilms under controlled flow conditions

  • Use fluorescence microscopy to visualize biofilm architecture

  • Apply COMSTAT analysis for quantitative biofilm characterization

  • Compare structural parameters between wild-type and mutant strains

Surface Colonization Studies

  • Evaluate attachment to relevant surfaces (quartz sand has been used successfully)

  • Examine colonization at different temperatures

  • Use scanning electron microscopy to visualize attachment patterns

  • Quantify attached cells via CFU counts or qPCR methods

Molecular Analyses

  • RNA-seq to compare gene expression profiles in planktonic vs. biofilm states

  • Identify genes co-regulated with msbA during biofilm formation

  • Examine potential interactions between msbA and known biofilm-related genes (e.g., cat1)

This multi-faceted approach would provide insights into whether msbA plays a direct role in biofilm formation (through membrane remodeling during attachment) or an indirect role (through general cell physiology). Given that P. arcticus biofilms may represent an adaptation to limited water availability in permafrost environments , understanding msbA's role could reveal important mechanisms of survival in extreme conditions.

How can researchers design experiments to study the interaction between P. arcticus msbA and membrane lipids at different temperatures?

Studying the interaction between P. arcticus msbA and membrane lipids across temperature gradients requires specialized techniques that account for the protein's cold-adapted properties. The following experimental design is recommended:

Membrane Composition Analysis

  • Grow P. arcticus at multiple temperatures (-6°C, 0°C, 17°C, 22°C)

  • Extract total membrane lipids using chloroform-methanol extraction

  • Analyze lipid profiles by thin-layer chromatography and mass spectrometry

  • Quantify changes in lipid A structure and membrane phospholipid composition

Protein-Lipid Binding Studies

  • Microscale Thermophoresis (MST)

    • Label purified recombinant msbA with fluorescent dye

    • Titrate with different lipids extracted from P. arcticus

    • Measure binding affinities at various temperatures

  • Surface Plasmon Resonance (SPR)

    • Immobilize msbA on sensor chip

    • Flow lipid preparations across the surface

    • Determine binding kinetics at temperatures from 4°C to 22°C

Functional Reconstitution

  • Create proteoliposomes with defined lipid compositions

    • Use native P. arcticus lipids extracted from cells grown at different temperatures

    • Create synthetic lipid mixtures with varying degrees of unsaturation

  • Measure transport activity as a function of:

    • Temperature (range: -6°C to 22°C)

    • Lipid composition

    • Membrane fluidity (assessed by fluorescence anisotropy)

Molecular Dynamics Simulations

  • Generate structural models of P. arcticus msbA

  • Simulate protein behavior in membrane environments with varying lipid compositions

  • Analyze temperature effects on protein-lipid interactions

  • Identify key lipid-binding residues for experimental validation

This integrated approach would reveal how P. arcticus msbA function is modulated by temperature-dependent changes in membrane composition, providing insights into the molecular mechanisms of cold adaptation in this extremophile.

How should researchers interpret changes in msbA expression in relation to other genes during temperature adaptation?

Interpreting msbA expression changes requires contextualizing them within the broader transcriptional response of P. arcticus to temperature shifts. Based on transcriptome studies of P. arcticus, the following analytical framework is recommended:

Co-expression Network Analysis

  • Construct gene co-expression networks from RNA-seq data across temperature points

  • Identify modules containing msbA to determine its functional associates

  • Compare with known temperature-responsive gene clusters

Comparative Analysis with Known Temperature-Responsive Systems

P. arcticus exhibits several patterns during temperature adaptation that should inform msbA expression analysis:

  • Resource Efficiency Response: Below 4°C, P. arcticus shows downregulation of genes for transcription, translation, and energy production . If msbA follows this pattern, it suggests its function is maintained with minimal resources at low temperatures.

  • Isozyme Exchange: P. arcticus employs isozyme exchange for D-alanyl-D-alanine carboxypeptidases (dac1 and dac2) and DEAD-box RNA helicases at different temperatures . Researchers should check if msbA has paralogs that show reciprocal expression patterns.

  • Biosynthetic Pathway Shifts: At low temperatures, P. arcticus upregulates specific biosynthetic pathways (proline, tryptophan, methionine) . Correlation between msbA expression and these pathways could indicate functional relationships.

  • Limited Cold Shock Response: Unlike other organisms, P. arcticus shows minimal upregulation of chaperones at low temperatures . If msbA expression differs from this pattern, it suggests a specific role in cold adaptation.

Statistical Analysis Framework

Analysis TypeMethodInterpretation Guide
Differential ExpressionDESeq2 or EdgeRLog2 fold change > 1 and adjusted p-value < 0.05 indicates significant regulation
Time Course AnalysismaSigPro or STEMCategorize expression patterns (early/late response, transient/sustained)
Multi-factorial AnalysisTwo-way ANOVASeparate effects of temperature, time, and their interaction
Enrichment AnalysisGO/KEGG enrichmentIdentify functional categories co-regulated with msbA

By applying this analytical framework, researchers can determine whether msbA regulation is part of the general resource efficiency response or represents a specific adaptation mechanism for membrane transport at low temperatures.

Experimental Design Considerations

  • Temperature Range Selection:

    • Test P. arcticus msbA across its physiological range (-10°C to 28°C)

    • Test mesophilic msbA across its physiological range (typically 20°C to 42°C)

    • Include overlapping temperatures (e.g., 22°C) for direct comparison

  • Normalization Approaches:

    • Normalize activity to optimal temperature for each organism

    • Use temperature compensation factors to account for general effects on reaction rates

    • Calculate relative activity ratios rather than absolute values

  • Substrate Selection:

    • Use identical substrates for direct comparison when possible

    • Consider native substrate differences when interpreting results

    • Test with both native and non-native lipid compositions

Analytical Framework

ParameterPsychrophilic AnalysisMesophilic AnalysisComparison Metrics
Temperature OptimumDetermine Topt for P. arcticus msbADetermine Topt for mesophilic msbAΔTopt between species
Thermal StabilityMeasure half-life at various temperaturesMeasure half-life at various temperaturesCompare stability curves
Catalytic EfficiencyCalculate kcat/Km across temperature rangeCalculate kcat/Km across temperature rangeEfficiency ratio at each temperature
Activation EnergyCalculate Ea from Arrhenius plotsCalculate Ea from Arrhenius plotsΔEa between species
Structural FlexibilityMeasure intrinsic fluorescence changesMeasure intrinsic fluorescence changesCompare conformational dynamics

Interpretative Framework

When interpreting comparative data, researchers should consider:

  • The trade-off between activity and stability in cold-adapted enzymes

  • The higher specific activity often observed for psychrophilic enzymes at low temperatures

  • The potential role of post-translational modifications in regulating activity

  • The influence of different cellular environments (membrane composition, cytoplasmic components) on protein function

  • Evolutionary history and potential convergent adaptation

By addressing these considerations, researchers can distinguish between general temperature effects and specific adaptive features of P. arcticus msbA that enable its function in permafrost environments.

How can transcriptomic data be integrated to understand the role of msbA in P. arcticus' adaptation to permafrost conditions?

Integrating transcriptomic data to understand msbA's role in P. arcticus adaptation requires a multi-layered analytical approach:

Data Integration Strategy

  • Multi-omics Correlation Analysis

    • Correlate msbA expression with:

      • Membrane lipid profiles at different temperatures

      • Protein abundance levels (proteomics)

      • Metabolomic shifts in lipid-related pathways

    • This correlation analysis would reveal how msbA expression coordinates with broader cellular adaptations

  • Comparative Transcriptomics

    • Compare P. arcticus transcriptional responses to:

      • Different stressors (cold, desiccation, starvation)

      • Different growth phases at low temperatures

      • Other psychrophilic bacteria

    • This would position msbA within general or specific stress responses

  • Temporal Regulation Analysis

    • Analyze the kinetics of msbA expression during:

      • Acute cold shock response

      • Long-term adaptation to permafrost-like conditions

      • Transition between temperature states

    • This would distinguish between immediate vs. adaptive regulation

Analytical Framework

P. arcticus exhibits two distinct metabolic states: a fast-growth state at optimal temperature (17°C) and a resource efficiency state at temperatures below 4°C . When analyzing msbA within this context, researchers should:

  • Determine if msbA expression follows the general pattern of downregulation seen for energy production and biosynthetic pathway genes at low temperatures

  • Assess whether msbA shows evidence of isozyme exchange, as observed for other genes in P. arcticus

  • Examine correlation between msbA expression and genes involved in membrane remodeling at low temperatures

  • Compare msbA regulation to the limited cold shock response observed in P. arcticus (only clpB and hsp33 upregulated at low temperature)

Functional Validation Approaches

To validate inferences from transcriptomic data:

  • Heterologous expression of P. arcticus msbA in mesophilic hosts followed by phenotypic analysis

  • Creation of reporter constructs to monitor msbA promoter activity in real-time

  • ChIP-seq to identify transcription factors regulating msbA expression

  • CRISPR interference to modulate msbA expression levels and assess phenotypic consequences

This integrated approach would position msbA within P. arcticus' broader survival strategy in permafrost conditions, distinguishing whether it represents a core adaptation mechanism or a supporting physiological response.

How might understanding P. arcticus msbA function contribute to biotechnological applications?

The unique properties of P. arcticus msbA offer several promising biotechnological applications:

Cold-Active Biocatalysts for Industrial Processes

The ability of P. arcticus proteins to function at low temperatures makes them valuable for industrial processes requiring low-temperature operations. Specific applications for msbA-derived technology include:

  • Bioremediation Technologies:

    • Development of cold-active membrane systems for pollutant transport and degradation

    • Engineered microorganisms with enhanced membrane transport capabilities at low temperatures

    • Low-temperature wastewater treatment systems incorporating cold-adapted transport proteins

  • Pharmaceutical Applications:

    • Cold-stable liposome formulations for drug delivery

    • Temperature-sensitive drug release systems

    • Membrane protein expression systems optimized for low-temperature production

  • Food Industry Applications:

    • Cold-active enzyme systems for food processing

    • Improved starter cultures for fermentation at refrigeration temperatures

    • Enhanced food preservation technologies

Structural Insights for Protein Engineering

Understanding the structural basis of P. arcticus msbA cold adaptation could inform rational design of other proteins:

  • Identification of key residues responsible for low-temperature activity

  • Development of predictive models for cold-adaptation of membrane proteins

  • Creation of designer proteins with optimized activity profiles across temperature ranges

Synthetic Biology Applications

P. arcticus msbA could serve as a module in synthetic biology applications:

  • Development of synthetic cells capable of functioning at low temperatures

  • Creation of temperature-responsive biosensors using msbA regulatory elements

  • Engineering of organisms with enhanced cold tolerance for various applications

The combination of structural insights, functional characterization, and expression data from P. arcticus msbA research provides valuable blueprints for these biotechnological applications, potentially enabling new processes in environments where mesophilic systems are ineffective.

What are the most significant unanswered questions regarding P. arcticus msbA function and regulation?

Despite advances in understanding P. arcticus biology, several critical questions about msbA remain unanswered:

Structural Biology Questions

  • Cold-Adaptation Mechanisms: What specific structural features distinguish P. arcticus msbA from mesophilic homologs? Do these differences manifest in altered dynamics, substrate binding, or catalytic mechanisms?

  • Conformational States: How does temperature affect the conformational cycle of the protein during its transport mechanism? Are there unique intermediate states at low temperatures?

  • Lipid Interactions: What specific lipid interactions are critical for msbA function in P. arcticus, and how do these differ from mesophilic counterparts?

Regulatory Questions

  • Temperature-Dependent Regulation: What transcription factors and regulatory elements control msbA expression across P. arcticus' temperature range? Does regulation occur primarily at the transcriptional, translational, or post-translational level?

  • Integration with Stress Responses: How is msbA regulation integrated with other stress responses, particularly desiccation tolerance and starvation responses that are relevant to permafrost survival?

  • Long-Term Adaptation: How does msbA expression change during long-term adaptation to stable low temperatures versus acute cold shock?

Physiological Questions

  • Substrate Specificity: Does P. arcticus msbA transport additional substrates beyond lipid A? Has substrate specificity evolved differently in this psychrophile?

  • Functional Redundancy: Are there functional homologs or alternative pathways that can compensate for reduced msbA activity at extremely low temperatures?

  • Biofilm Integration: What is the specific role of msbA in biofilm formation, which appears to be an important survival strategy in permafrost conditions?

Addressing these questions will require integrated approaches combining structural biology, molecular genetics, biochemistry, and systems biology. The answers would not only enhance our understanding of P. arcticus' survival mechanisms but also advance general knowledge of protein adaptation to extreme environments.

What emerging technologies might advance research on P. arcticus msbA and similar membrane proteins?

Several cutting-edge technologies show promise for advancing research on P. arcticus msbA and other cold-adapted membrane proteins:

Structural Biology Advances

  • Cryo-Electron Microscopy (Cryo-EM):

    • Particularly suitable for studying cold-adapted proteins in near-native conditions

    • Recent advances in resolution now permit atomic-level insights into membrane protein structures

    • Time-resolved cryo-EM could capture conformational changes during the transport cycle

  • Integrative Structural Biology:

    • Combining multiple techniques (X-ray crystallography, NMR, SAXS, computational modeling)

    • Hydrogen-deuterium exchange mass spectrometry to map protein dynamics at different temperatures

    • Cross-linking mass spectrometry to identify protein-protein and protein-lipid interactions

Functional Characterization Technologies

  • Single-Molecule Techniques:

    • Single-molecule FRET to monitor conformational changes at different temperatures

    • Patch-clamp fluorometry to correlate structural changes with transport function

    • Magnetic tweezers to measure force generation during transport cycles

  • Advanced Microscopy:

    • Super-resolution microscopy to visualize membrane protein organization in native membranes

    • Correlative light and electron microscopy to connect function with ultrastructure

    • Cryogenic super-resolution fluorescence microscopy to visualize proteins at low temperatures

Genetic and Systems Biology Approaches

  • CRISPR Technologies:

    • CRISPR interference for tunable gene repression

    • CRISPR activation for enhanced expression

    • Base editing for precise genetic modifications without double-strand breaks

    • Prime editing for flexible gene editing in difficμLt-to-modify organisms

  • Microfluidics and Lab-on-Chip Applications:

    • Gradient generators to study protein function across temperature ranges simultaneously

    • Droplet microfluidics for high-throughput functional assays

    • Organ-on-chip systems to study membrane protein function in complex environments

  • Computational Approaches:

    • Enhanced molecular dynamics simulations incorporating specialized force fields for membrane environments

    • Machine learning approaches to predict temperature effects on protein structure and function

    • Systems biology modeling to integrate multiomics data

These emerging technologies would enable researchers to address the multifaceted questions surrounding P. arcticus msbA function, potentially revealing new principles of protein adaptation to extreme conditions and inspiring novel biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.