Recombinant Psychrobacter arcticus Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Description

Overview and Biological Role

Recombinant Psychrobacter arcticus Na(+)-translocating NADH-quinone reductase subunit E (nqrE) is a key component of the Na(+)-NQR complex, a respiratory enzyme critical for sodium ion translocation across bacterial membranes. This enzyme enables energy conservation in extremophiles like P. arcticus, which thrives in subzero Siberian permafrost environments . The recombinant form is engineered for biochemical and structural studies, offering insights into cold-adaptation mechanisms and bioenergetics.

Production and Purification

ParameterSpecification
Expression HostE. coli
TagHis tag (N-terminal)
Purity>90% (SDS-PAGE)
FormLyophilized powder
Storage-20°C/-80°C in Tris/PBS buffer with 50% glycerol

Recombinant nqrE is produced via heterologous expression, followed by affinity chromatography and lyophilization. The inclusion of trehalose (6%) in the storage buffer enhances stability during freeze-thaw cycles .

Functional Insights

  • Sodium Translocation: The Na(+)-NQR complex couples NADH oxidation to Na(+) transport, generating electrochemical gradients essential for ATP synthesis and nutrient uptake .

  • Cold Adaptation: P. arcticus nqrE exhibits structural adaptations, such as reduced proline/arginine usage and increased glycine content, enhancing flexibility at low temperatures .

  • Kinetic Activity: The enzyme operates optimally at 4–15°C, consistent with its psychrophilic origin .

Research Applications

  • Mechanistic Studies: Used to investigate ion-pumping mechanisms in extremophiles .

  • Biotechnological Potential: Stability at subzero temperatures makes it a candidate for industrial enzymes requiring cold-active properties .

  • Comparative Genomics: Sequence comparisons with homologs (e.g., Pseudoalteromonas haloplanktis nqrE, UniProt Q3IHN9) reveal evolutionary adaptations to diverse environments .

Handling and Stability

  • Reconstitution: Resuspend in deionized water (0.1–1.0 mg/mL) with 50% glycerol for long-term storage .

  • Avoid: Repeated freeze-thaw cycles; working aliquots stored at 4°C degrade within a week .

Key Research Findings

  • Genomic Analysis: The nqrE gene (Psyc_2108) is part of a conserved operon critical for cold-adapted metabolism in P. arcticus .

  • Structural Integrity: Mutagenesis studies highlight the role of transmembrane domains in maintaining sodium channel function under freezing conditions .

  • Biophysical Behavior: Redox titrations reveal a 2Fe-2S center and three flavin cofactors, consistent with electron transfer capabilities .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nqrE; Psyc_2108; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Psychrobacter arcticus (strain DSM 17307 / 273-4)
Target Names
nqrE
Target Protein Sequence
MGHYVSLFITSVFIENMALAYFLGMCTFLAVSKKVSTAIGLGVAVVVVMAITVPLNNLLF QFILKDGALAWAGFPDIDLSFLGLLSYIGLIAATVQILEMFLDKFVPSLYNALGVFLPLI TVNCAILGGVLFMVERDYNFGESVVYGVGAGFGWALAITALAGIREKLKYSDIPAPLRGL GITFITVGLMSLGFMSFGGMSI
Uniprot No.

Target Background

Function

The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions, coupled with the transport of Na+ ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.

Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Na(+)-translocating NADH-quinone reductase (NQR) complex in Psychrobacter arcticus?

The Na(+)-translocating NADH-quinone reductase (NQR) complex serves as a critical respiratory enzyme in the electron transport chain of Psychrobacter arcticus. It couples the oxidation of NADH to the reduction of quinones while simultaneously translocating sodium ions across the cell membrane. This process generates an electrochemical gradient that drives various cellular functions, including ATP synthesis. The NQR complex is composed of six subunits (NQR1-6), with nqrE being one of the essential components. In Psychrobacter arcticus, which thrives at temperatures as low as -10°C, this complex likely represents a specialized adaptation for maintaining energy metabolism under extreme cold conditions where conventional proton-based bioenergetics might be less efficient .

What structural features characterize the nqrE subunit in Psychrobacter arcticus?

The nqrE subunit from Psychrobacter arcticus is a highly hydrophobic membrane protein consisting of 202 amino acids with the sequence: "MGHYVSLFITSVFIENMALAYFLGMCTFLAVSKKVSTAIGLGVAVVVVMAITVPLNNLLFQFILKDGALAWAGFPDIDLSFLGLLSYIGLIAATVQILEMFLDKFVPSLYNALGVFLPLITVNCAILGGVLFMVERDYNFGESVVYGVGAGFGWALAITALAGIREKLKYSDIPAPLRGLGITFITVGLMSLGFMSFGGMSI" . Analysis of this sequence reveals multiple predicted transmembrane domains, consistent with its role as an integral membrane protein. The protein contains regions likely involved in quinone binding and interaction with other NQR subunits. Like other proteins in Psychrobacter arcticus, nqrE exhibits amino acid compositions that favor increased structural flexibility at low temperatures, including reduced usage of acidic amino acids, proline, and arginine . These adaptations likely enable the protein to maintain functionality even in the permanently frozen permafrost environment.

How does cold adaptation manifest in the amino acid composition of Psychrobacter arcticus proteins including nqrE?

Psychrobacter arcticus exhibits distinctive amino acid adaptations that facilitate protein functionality at extremely low temperatures. Genome analysis has revealed that a significant portion of the P. arcticus proteome (56% of genes) shows reduced usage of acidic amino acids, proline, and arginine compared to mesophilic counterparts . This modification increases protein flexibility at low temperatures where proteins typically become more rigid. The ratio of cold-adapted to heat-adapted genes calculated for various indicators (hydrophobicity, proline content, acidic residue content, and arginine/lysine ratio) ranged from 1.35 to 3.0, strongly indicating cold adaptation at the protein sequence level . While the search results don't specifically analyze nqrE in this context, it likely exhibits similar compositional adaptations as part of the broader proteome adjustment strategy. These modifications collectively allow for maintenance of appropriate structural dynamics and catalytic efficiency even at subzero temperatures.

What expression systems are optimal for producing recombinant P. arcticus nqrE protein?

  • Specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3))

  • Temperature-controlled expression protocols (lower temperatures) that better match the native conditions of this psychrophilic organism

  • Codon optimization for improved translation efficiency in the heterologous host

  • Incorporation of affinity tags (His-tag is common) to facilitate purification

Alternative expression systems including yeast, mammalian cells, or baculovirus are available but typically at higher cost . For functional studies requiring proper membrane insertion and folding, expression in bacterial systems phylogenetically closer to Psychrobacter may provide advantages, though specialized vectors may be needed as standard E. coli plasmids like pBBR1 MCS-2 have been found to be inactive in some Psychrobacter strains .

What purification strategies are most effective for isolating functional recombinant nqrE?

Purification of recombinant nqrE, as a hydrophobic membrane protein, requires specialized approaches to maintain structural integrity and function:

  • Membrane fraction isolation from expression host cells through differential centrifugation

  • Detergent-based solubilization utilizing mild detergents such as n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin

  • Affinity chromatography, typically utilizing His-tagged versions of the protein for immobilized metal affinity chromatography (IMAC)

  • Size exclusion chromatography as a polishing step to achieve high purity

  • Buffer optimization containing appropriate detergent concentrations, stabilizing agents (glycerol, trehalose), and pH conditions

The choice of detergent is particularly critical, as it must effectively extract the protein from the membrane while preserving native-like conformations. Purity assessment can be performed via SDS-PAGE, with specialized staining methods being necessary as traditional methods may not adequately detect highly hydrophobic proteins . For functional studies, reconstitution into proteoliposomes may be required to assess activity in a membrane environment.

How stable is recombinant nqrE under various storage and experimental conditions?

According to product information, recombinant nqrE exhibits moderate stability with specific storage requirements. The protein is typically supplied in a Tris-based buffer containing 50% glycerol, optimized for stability . Recommended storage conditions include:

  • Long-term storage at -20°C or -80°C

  • Working aliquots maintained at 4°C for up to one week

  • Avoidance of repeated freeze-thaw cycles, which can significantly reduce protein activity

The high glycerol content (50%) in storage buffers serves as a cryoprotectant, preventing ice crystal formation that could damage protein structure during freezing. For experimental applications, researchers should prepare small working aliquots upon initial thawing to minimize repeated freezing. Activity loss may occur more rapidly at higher temperatures, consistent with the protein's adaptation to cold environments. Stability may also be influenced by buffer composition, with factors such as pH, salt concentration, and presence of reducing agents potentially affecting longevity and activity retention.

What experimental techniques can be employed to assess recombinant nqrE activity?

Assessing the activity of recombinant nqrE typically requires reconstitution approaches since the individual subunit may not display activity in isolation. Multiple complementary techniques can provide comprehensive functional characterization:

  • Spectrophotometric NADH oxidation assays measuring the rate of NADH consumption when the complete NQR complex is reconstituted

  • Quinone reduction assays monitoring the reduction of ubiquinone analogs

  • Sodium ion transport measurements using fluorescent indicators or radioactive Na+ tracers in reconstituted proteoliposomes

  • Membrane potential measurements utilizing voltage-sensitive dyes

  • Differential scanning calorimetry to assess protein thermostability across temperature ranges

  • Protein-protein interaction studies to verify proper assembly with other NQR subunits

For cold-adapted proteins like nqrE from P. arcticus, activity assessments at different temperatures (including subzero conditions) can provide valuable insights into cold adaptation mechanisms. Comparative analyses with homologous proteins from mesophilic bacteria may highlight functional differences related to psychrophilic adaptation. Enzyme kinetics parameters (Km, Vmax) determined at various temperatures can quantify the degree of cold adaptation.

How does P. arcticus nqrE compare structurally and functionally to homologous proteins from other bacteria?

Comparative analysis of nqrE proteins from different bacterial species reveals both conservation of core functional elements and adaptive variations. The P. arcticus nqrE protein (202 amino acids) shows significant sequence similarity to homologs from other bacteria, such as Vibrio fischeri nqrE (198 amino acids) . Key differences include:

  • Altered amino acid composition reflecting cold adaptation in P. arcticus, with likely reduced content of acidic residues, proline, and arginine compared to mesophilic homologs

  • Potential variations in transmembrane domain organization optimized for functioning in different membrane environments

  • Modifications that may affect interaction interfaces with other NQR complex subunits

What role does the NQR complex play in P. arcticus adaptation to extreme cold environments?

The NQR complex plays a crucial role in P. arcticus' remarkable ability to survive in permanently frozen permafrost at temperatures as low as -10°C . Several aspects of this system appear particularly advantageous for cold adaptation:

  • The use of Na+ instead of H+ for creating electrochemical gradients may provide advantages in cold environments where membrane permeability to protons could be problematic

  • The complex contributes to energy conservation under low-temperature conditions where reaction rates are inherently slower

  • The Na+-dependent bioenergetics may integrate with P. arcticus' broader metabolic adaptations, such as preference for acetate as an energy source, which "easily diffuses into the cell without costly transport systems"

  • The amino acid adaptations in the NQR complex proteins, including nqrE, increase flexibility at low temperatures, maintaining function where rigid proteins would lose activity

Genome analysis of P. arcticus has revealed that differential amino acid usage was more common in gene categories essential for cell growth and reproduction, suggesting evolutionary selection specifically for growth at low temperatures . The NQR complex likely represents an essential component of this cold-adaptive energy metabolism strategy.

What applications benefit most from utilizing recombinant P. arcticus nqrE in research?

Recombinant P. arcticus nqrE offers valuable opportunities for diverse research applications:

  • Structural biology studies investigating cold adaptation in membrane proteins using techniques such as X-ray crystallography, cryo-EM, or NMR spectroscopy

  • Biophysical characterization of psychrophilic membrane proteins to understand flexibility-function relationships at low temperatures

  • Comparative biochemistry between psychrophilic and mesophilic NQR complexes to elucidate evolutionary adaptations

  • Biotechnological applications exploiting cold-active properties for bioenergy systems that function at low temperatures

  • Drug discovery targeting bacterial respiratory complexes, with potential applications in antimicrobial development

  • Protein engineering to transfer cold-adaptive properties to industrial enzymes

  • Fundamental research on bacterial bioenergetics in extreme environments

Common experimental applications include ELISA and Western blotting for detection and quantification . The unique properties of cold-adapted proteins like nqrE may also inspire biomimetic approaches in nanotechnology and materials science. Understanding the molecular basis of cold adaptation in essential cellular processes provides broader insights into how life adapts to extreme environmental conditions.

How can researchers differentiate between basic and advanced functional studies of recombinant nqrE?

The investigation of recombinant nqrE spans a continuum from basic to advanced research approaches:

Basic Studies:

  • Sequence analysis and prediction of structural features using bioinformatics tools

  • Expression optimization and purification protocol development

  • SDS-PAGE and Western blot analysis to confirm protein identity and purity

  • Basic stability assessments under varying conditions

  • Preliminary activity measurements of reconstituted complexes

Advanced Studies:

  • High-resolution structural determination using cryo-EM, X-ray crystallography, or advanced NMR techniques

  • Single-molecule studies examining conformational dynamics during catalytic cycles

  • Comprehensive biophysical characterization across temperature ranges from -10°C to 30°C

  • Site-directed mutagenesis to identify critical residues for cold adaptation

  • Reconstitution of complete NQR complexes with defined lipid compositions mimicking native membranes

  • Integration of complementary techniques (EPR spectroscopy, mass spectrometry, molecular dynamics simulations) to build comprehensive mechanistic models

Advanced studies typically require specialized equipment capable of maintaining low temperatures during measurements and may involve custom-designed experimental setups not commercially available. These studies also frequently employ multiple complementary approaches to build comprehensive understanding rather than relying on single techniques.

What genetic approaches can be used to investigate nqrE function in P. arcticus?

Genetic manipulation of P. arcticus to study nqrE function presents both challenges and opportunities:

  • Transformation systems: While standard E. coli plasmids with ColE1- and p15a-type replication systems have been reported to work in P. arcticus 274-3, inconsistent results have led to the development of specific shuttle vectors for Psychrobacter species

  • Gene knockout strategies: Creation of nqrE deletion mutants through homologous recombination or CRISPR-Cas9 approaches would allow assessment of the gene's essentiality and phenotypic consequences

  • Complementation studies: Reintroduction of wild-type or modified nqrE genes into knockout strains can confirm phenotypic observations and allow structure-function analysis

  • Reporter gene fusions: Creation of transcriptional or translational fusions to monitor expression patterns under different conditions

  • Site-directed mutagenesis: Introduction of specific amino acid changes to test hypotheses about structure-function relationships

Recent developments specifically for Psychrobacter species include the construction of two novel shuttle vectors (pPS-NR and pPS-BR) with increased carrying capacity that may facilitate genetic engineering approaches . These genetic tools enable more sophisticated investigations of nqrE function in its native context, complementing biochemical studies of the recombinant protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.