Recombinant Psychrobacter arcticus NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Introduction

NADH-quinone oxidoreductase subunit A (NuoA) is a component of the NADH:quinone oxidoreductase (NDH-1) complex, also known as Complex I, which is found in the bacterium Psychrobacter arcticus . NDH-1 is a crucial enzyme complex in the respiratory chain, catalyzing the transfer of electrons from NADH to quinones and coupling this redox reaction to proton translocation across the cytoplasmic membrane . This process conserves redox energy in a proton gradient that the cell can then use .

Biological Properties

NuoA is involved in oxidoreductase activity, specifically acting on NADH or NADPH . The NDH-1 complex, which includes NuoA, shuttles electrons from NADH, via flavin mononucleotide (FMN) and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain . Ubiquinone is thought to be the immediate electron acceptor for this enzyme in Psychrobacter arcticus . For every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane .

Function and Role in Energy Metabolism

NADH:quinone oxidoreductases are essential because they connect almost all catabolic pathways to respiratory chains . Staphylococcus aureus presents two genes encoding NDH-2s (NDH-2A and NDH-2B) and lacks genes coding for Complex I, the canonical respiratory NADH:quinone oxidoreductase . The action of NDH-2s becomes crucial for the regeneration of $$NAD^+$$ and, consequently, for the progression of metabolism .

In Psychrobacter arcticus, the expression of genes involved in energy production was found to be downregulated at low temperatures .

Psychrobacter sp. PAMC 21119

Low temperatures upregulate genes for translation, ribosomal structure, and biogenesis, while downregulating lipid transport and metabolism . The most prominent upregulated proteins responding to cold are involved in metabolite transport, protein folding, and membrane fluidity. Proteins involved in energy production and conversion, and heme protein synthesis, were downregulated .

Table 1: Differentially Expressed Proteins of Psychrobacter sp. PAMC 21119 at Two Different Temperatures

SSPProteinAccession numberKEGG IDGene nameTheoretical MrTheoretical pIObserved MrObserved pISequence coverage (%)Change (fold)t-test
8730NADH:ubiquinone oxidoreductasegi|648256035K00332nuoC674696.18644405.99602.30.00096
5537Methylmalonate-semialdehyde dehydrogenasegi|497886961K00140mmsA531805.21533605.12332.20.0039
5326NADPH:quinone reductasegi|497886587K19267qorB358015.27397605.16212.00.0373
6639Succinate dehydrogenase flavoprotein subunit

Functional Categorization

The most crucial quinone reductases are NADH:quinone oxidoreductases because they connect almost all catabolic pathways to respiratory chains . Three enzymes may perform this reaction: respiratory Complex I, type 2 NADH:quinone oxidoreductase (NDH-2), and $$Na^+$$ .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs an additional fee.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag type, please inform us, and we will prioritize its development.
Synonyms
nuoA; Psyc_0584; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-207
Protein Length
full length protein
Species
Psychrobacter arcticus (strain DSM 17307 / 273-4)
Target Names
nuoA
Target Protein Sequence
MSAFNWSAIAFILAAIALVVFMLVVPRLLGGRSHGSQKEEIFEAGVVGSGNARIRLSAKF YLVAIFFVIFDLEALYLYAYAVSVREAGWLGFAAAAIFITILIIGLVYELSLGAMNWAPA DKLRKKARLYAAPAGFSLADITKFDGVDELMVDPTGKIPAQSSGQINVSNNIETNRRHLQ NIDHINTTGNVTSVDFATSAQTDNIKR
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is believed to be the primary electron acceptor. The enzyme couples this redox reaction to proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, thus conserving redox energy within a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Psychrobacter arcticus and what ecological significance does it have?

Psychrobacter arcticus is a Gram-negative, nonmotile bacterial species first isolated from Siberian permafrost. Its type strain is designated as 273-4 (=DSM 17307=VKM B-2377). The organism belongs to the taxonomic family Moraxellaceae within the Gammaproteobacteria class . As a cold-adapted microorganism isolated from permafrost environments, P. arcticus represents an important model system for understanding bacterial adaptation to extreme conditions. The bacterium has evolved specialized cellular components, including modified enzyme systems, that enable its survival and metabolic activity at low temperatures. Research with P. arcticus provides insights into cold-adaptation mechanisms with potential applications in biotechnology and astrobiology.

What is NADH-quinone oxidoreductase subunit A (nuoA) and what role does it play in bacterial metabolism?

NADH-quinone oxidoreductase subunit A (nuoA) is a component of the NDH-1-type NADH dehydrogenase complex (EC 1.6.99.5), also known as Complex I in the respiratory electron transport chain . This enzyme complex plays a crucial role in energy metabolism by catalyzing the transfer of electrons from NADH to quinones, contributing to the generation of a proton motive force that drives ATP synthesis. In P. arcticus, nuoA forms part of the membrane-bound respiratory complex that enables the organism to maintain energy production under variable environmental conditions. The protein is encoded by the nuoA gene (locus tag Psyc_0584) in the P. arcticus genome . The nuoA subunit is particularly important for the structural integrity and proper assembly of the entire NADH dehydrogenase complex.

How does nuoA contribute to the electron transport chain in Psychrobacter arcticus compared to other bacteria?

The NADH-quinone oxidoreductase complex, of which nuoA is a subunit, forms an essential component of the respiratory electron transport chain in many bacteria. In P. arcticus and other bacteria adapted to extreme environments, this complex must function efficiently despite challenging conditions such as low temperatures or oxygen limitation. NDH-1-type NADH dehydrogenase complexes typically couple electron transfer to proton translocation across the membrane, contributing to energy conservation .

Compared to mesophilic bacteria, the NADH-quinone oxidoreductase in P. arcticus likely possesses structural adaptations that maintain flexibility and catalytic efficiency at low temperatures. The electron transport chain in P. arcticus, similar to those in other bacteria, likely incorporates cytochrome complexes that work in concert with the NADH dehydrogenase. Many bacteria possess cytochrome bc1 complex (EC 1.10.2.2) and terminal oxidases such as the cbb3–type cytochrome c oxidase (EC 1.9.3.1), which facilitate growth under low oxygen conditions . These components, working together with nuoA-containing complexes, enable P. arcticus to maintain energy production in its native permafrost habitat.

What regulatory mechanisms control nuoA expression in P. arcticus?

Based on studies of similar systems in other bacteria, nuoA expression in P. arcticus is likely regulated in response to oxygen availability and energetic demands. In some bacteria, the ArcA/ArcB two-component system plays a crucial role in regulating genes involved in respiratory and fermentative metabolism under varying oxygen conditions. Evidence from other systems suggests that nuoA may be directly regulated by the ArcA transcription factor .

The ArcA/ArcB system typically functions as follows:

  • The ArcB sensor kinase detects changes in the cellular redox state

  • Under reducing conditions, ArcB autophosphorylates and transfers the phosphate to ArcA

  • Phosphorylated ArcA binds to specific promoter regions, regulating gene expression

  • Genes encoding components of aerobic pathways, like nuoA, may be repressed when oxygen is limited

This regulatory mechanism would allow P. arcticus to adapt its energy metabolism to the available electron acceptors in its environment, optimizing energy production under variable conditions.

How might cold adaptation affect the structure and function of nuoA in P. arcticus?

Cold-adapted enzymes typically show structural modifications that increase flexibility and catalytic efficiency at low temperatures. For membrane proteins like nuoA, cold adaptation may involve:

  • Altered amino acid composition in membrane-spanning regions to maintain appropriate fluidity

  • Modified protein-protein interactions to ensure proper complex assembly at low temperatures

  • Increased structural flexibility in key catalytic regions

  • Reduced stability at higher temperatures (a trade-off for low-temperature activity)

In P. arcticus, which survives in permafrost environments, nuoA likely exhibits these cold-adaptive features. The specific amino acid composition of P. arcticus nuoA, with its distinctive hydrophobic regions, may reflect adaptations that maintain protein function at temperatures where mesophilic homologs would be inactive . Research comparing nuoA from P. arcticus with homologs from mesophilic bacteria could reveal specific adaptations that contribute to cold tolerance.

What are optimal conditions for expression and purification of recombinant P. arcticus nuoA?

Based on general approaches for membrane protein expression and the specific characteristics of P. arcticus nuoA, the following methodology is recommended:

Expression System Selection:

  • E. coli BL21(DE3) or similar strains are typically suitable for recombinant expression

  • Consider using specialized strains designed for membrane protein expression

  • Expression vectors with tightly controlled inducible promoters (e.g., T7 promoter systems) are recommended

Expression Conditions:

  • Lower induction temperatures (16-20°C) often improve membrane protein folding

  • Induction with reduced IPTG concentrations (0.1-0.5 mM) for longer periods (16-24 hours)

  • Supplementation with specialized membrane protein expression enhancers may improve yields

Purification Strategy:

  • Initial extraction with mild detergents that preserve protein structure

  • Affinity chromatography using appropriate tags (His-tag is commonly employed)

  • Size exclusion chromatography for final purification

  • Consider including stabilizing agents throughout purification

Storage Recommendations:

  • Store purified protein at -20°C for short-term storage

  • For extended storage, maintain at -80°C in buffer containing 50% glycerol

  • Avoid repeated freeze-thaw cycles, as noted in product recommendations

What methods are effective for studying nuoA function within the NADH dehydrogenase complex?

Enzymatic Activity Assays:

  • NADH oxidation assays measuring absorbance decrease at 340 nm

  • Ubiquinone reduction assays

  • Artificial electron acceptor (e.g., ferricyanide) reduction assays

  • Coupled enzyme assays to monitor downstream electron transport events

Structural Analysis Approaches:

  • Membrane reconstitution experiments to assess activity in lipid environments

  • Crosslinking studies to identify subunit interactions within the complex

  • Single-particle cryo-electron microscopy for structural determination

  • Computational modeling based on homologous proteins with solved structures

Functional Studies:

  • Site-directed mutagenesis to identify essential residues

  • Complementation studies in knockout bacterial strains

  • Comparative biochemical characterization across temperature ranges

How can researchers effectively design experiments to study the role of nuoA in cold adaptation?

To investigate the role of nuoA in cold adaptation, researchers should consider a multi-faceted experimental design:

Comparative Genomics and Sequence Analysis:

  • Align nuoA sequences from psychrophilic, mesophilic, and thermophilic bacteria

  • Identify cold-adaptive signature residues through computational analysis

  • Construct phylogenetic trees to understand evolutionary relationships

Heterologous Expression Studies:

  • Express P. arcticus nuoA in mesophilic hosts at various temperatures

  • Create chimeric proteins with domains from mesophilic homologs

  • Assess temperature-dependent expression and activity profiles

Biochemical Characterization:

  • Compare enzyme kinetics across a temperature range (0-37°C)

  • Measure thermostability through thermal shift assays

  • Determine activation energy and other thermodynamic parameters

  • Assess structural flexibility using hydrogen-deuterium exchange or similar methods

Table 1: Recommended Temperature Points for nuoA Activity Assays

Temperature (°C)Relevance to P. arcticus physiology
0Native permafrost temperature range
4Standard cold room temperature
10Moderate cold stress for mesophiles
15Transition temperature
22Room temperature (control)
30Mild heat stress for psychrophiles
37Significant heat stress for psychrophiles

What techniques can be used to investigate the regulation of nuoA expression by oxygen availability?

Based on the known relationships between oxygen sensing, the ArcA/ArcB system, and respiratory gene regulation, researchers should consider these approaches:

Transcriptional Analysis:

  • qRT-PCR to quantify nuoA transcript levels under varying oxygen conditions

  • Reporter gene fusions (e.g., nuoA promoter-lacZ) to monitor expression in vivo

  • RNA-seq to identify co-regulated genes under aerobic vs. anaerobic conditions

  • Chromatin immunoprecipitation (ChIP) to identify regulatory protein binding sites

Protein-DNA Interaction Studies:

  • Electrophoretic mobility shift assays (EMSA) to detect ArcA binding to the nuoA promoter

  • DNase footprinting to precisely map binding sites

  • In vitro transcription assays with purified regulatory proteins

Genetic Approaches:

  • Construction of arcA and arcB deletion mutants to assess effects on nuoA expression

  • Site-directed mutagenesis of predicted regulatory binding sites

  • Complementation studies with wild-type and mutant regulators

The ArcA/ArcB two-component system has been shown to regulate genes encoding respiratory complex components including nuoA in other bacteria . Understanding this regulation in P. arcticus would provide insights into how this psychrophilic bacterium coordinates its energy metabolism with environmental oxygen availability.

What are the critical quality control steps when working with recombinant P. arcticus nuoA?

When working with recombinant nuoA, researchers should implement several quality control measures:

Verification of Expression:

  • Western blotting with antibodies against nuoA or affinity tags

  • Mass spectrometry confirmation of protein identity

  • N-terminal sequencing to confirm proper processing

Purity Assessment:

  • SDS-PAGE with appropriate staining methods

  • Size exclusion chromatography profiles

  • Mass spectrometry to detect contaminants

Functional Validation:

  • Activity assays using appropriate electron acceptors

  • Spectroscopic analysis of prosthetic groups if applicable

  • Protein-protein interaction assays to confirm association with other complex components

Storage Stability:

  • Monitor activity retention after storage at recommended conditions (-20°C with 50% glycerol)

  • Assess freeze-thaw stability through repeated activity measurements

  • Optimize buffer conditions to maximize stability

How does the weakness of P. arcticus LPS in triggering immune responses affect research applications?

Psychrobacter arcticus possesses hypoacylated lipopolysaccharide (LPS) that induces weak TLR4-mediated inflammatory responses in macrophages . This characteristic has several implications for research:

Immunological Studies:

  • P. arcticus could serve as a model for studying immune evasion mechanisms

  • Comparative studies with strongly immunogenic bacteria could reveal structural determinants of LPS recognition

  • The weak immunostimulatory properties might be advantageous when purifying recombinant proteins for applications where endotoxin contamination is problematic

Cell Culture Applications:

  • Reduced risk of immune activation when using P. arcticus-derived proteins in cell culture

  • Potential applications in systems where inflammatory responses could confound results

  • Consideration of endotoxin testing methods that may underestimate P. arcticus LPS due to its weak activity

Pathogenesis Research:

  • The weak TLR4 activation by P. arcticus LPS may lead to failure of local and systemic bacterial clearance in infected patients

  • This characteristic suggests P. arcticus could be used to study subtle immune modulation mechanisms

  • Researchers should consider this property when designing infection models or studying host-pathogen interactions

What are promising areas for further research on P. arcticus nuoA and related respiratory enzymes?

Several research directions could significantly advance our understanding of P. arcticus nuoA:

Structural Biology:

  • High-resolution structural determination of the complete NADH dehydrogenase complex from P. arcticus

  • Comparative structural analysis with mesophilic and thermophilic homologs

  • Molecular dynamics simulations to identify temperature-dependent conformational changes

Synthetic Biology:

  • Engineering mesophilic bacteria with P. arcticus respiratory components for cold-active bioremediation

  • Creation of chimeric enzymes combining cold-adapted and energy-efficient features

  • Development of biosensors based on cold-adapted electron transport components

Ecological and Evolutionary Studies:

  • Investigation of nuoA sequence and function across psychrophilic bacteria from diverse environments

  • Analysis of horizontal gene transfer events involving respiratory complex genes

  • Assessment of nuoA adaptation in bacterial communities across temperature gradients

By pursuing these research directions, scientists can gain deeper insights into the unique adaptations of P. arcticus and potentially develop biotechnological applications based on this cold-adapted bacterium's specialized respiratory machinery.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.