Recombinant Psychrobacter arcticus NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Psychrobacter arcticus NADH-quinone oxidoreductase subunit K (nuoK)

Recombinant Psychrobacter arcticus NADH-quinone oxidoreductase subunit K (nuoK) is a component of the NADH dehydrogenase complex, which plays a crucial role in the electron transport chain of bacteria. This enzyme complex is essential for generating ATP during oxidative phosphorylation by transferring electrons from NADH to quinone. Psychrobacter arcticus, a psychrotrophic bacterium, is capable of surviving in cold environments, making its enzymes of interest for biotechnological applications.

Function and Importance of NADH-quinone oxidoreductase

NADH-quinone oxidoreductase, also known as Complex I, is the first enzyme in the respiratory chain of bacteria. It catalyzes the transfer of electrons from NADH to quinone, coupled with the pumping of protons across the membrane, contributing to the proton gradient necessary for ATP synthesis. The nuoK subunit is part of this complex and is involved in the electron transfer process.

Psychrobacter arcticus and Cold Adaptation

Psychrobacter arcticus is a model organism for studying cold adaptation and survival strategies in extreme environments. Its enzymes, including NADH dehydrogenase, are adapted to function efficiently at low temperatures, which is crucial for its survival in permafrost environments . The ability of P. arcticus to grow at temperatures below 0°C makes its enzymes attractive for applications requiring low-temperature activity.

Research Findings and Data

While specific data on the recombinant nuoK subunit from Psychrobacter arcticus may be limited, research on similar enzymes from psychrotrophic bacteria highlights their unique properties:

Enzyme PropertyPsychrobacter arcticusGeneral Bacterial Enzymes
Temperature RangeCan function below 0°CTypically optimal above 20°C
Substrate AffinityAdapted for low-temperature kineticsOptimized for mesophilic conditions
Protein StructureMay exhibit flexible regions for cold adaptationGenerally more rigid structures

Table 1: Comparison of Enzyme Properties

This table illustrates the unique characteristics of enzymes from Psychrobacter arcticus compared to those from mesophilic bacteria.

Biotechnological Applications

The recombinant nuoK subunit and other enzymes from Psychrobacter arcticus have potential applications in biotechnology, particularly in processes requiring low-temperature activity. These could include:

  • Bioremediation: Enzymes adapted to cold conditions can be used for cleaning pollutants in cold environments.

  • Food Industry: Low-temperature active enzymes can be beneficial in food processing and preservation.

References

  1. KEGG GENOME: Psychrobacter arcticus. Genome info · Pathway map · Brite hierarchy, Module... NADH:quinone oxidoreductase, prokaryotes [PATH:par00190 par01100] M00149... .

  2. Genomes of ubiquitous marine and hypersaline Hydrogenovibrio. Presence of genes encoding NDH-1-type NADH: quinone oxidoreductase in related bacteria .

  3. Psychrobacter arcticus 273-4 Uses Resource Efficiency and Molecular Motion Adaptations for Subzero Temperature Growth. J. Bacteriol. .

  4. Comparative Transcriptomics of Cold Growth and Adaptive Features. Insights into Psychrobacter arcticus adaptations .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
nuoK; Psyc_0593; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-135
Protein Length
full length protein
Species
Psychrobacter arcticus (strain DSM 17307 / 273-4)
Target Names
nuoK
Target Protein Sequence
MVLAASVAQEVANVPFAHEVAGLVQPVAEAQNVLGLIPMSHGLILAGILFAIGLCGVMVR RNFLFMLMSLEIMMNAAALAFVVAGSRWVDPDGQIMFIFILTLAAAEAAIGLAILLRFYH QRGHLDVDSANEMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is thought to be the primary electron acceptor. This redox reaction is coupled to proton translocation, where four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thus generating a proton gradient that conserves redox energy.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Psychrobacter arcticus and why is its NADH-quinone oxidoreductase of interest to researchers?

Psychrobacter arcticus is a Gram-negative, nonmotile bacterial species first isolated from Siberian permafrost . It belongs to the Moraxellaceae family within the Pseudomonadales order. The NADH-quinone oxidoreductase (NDH-1) from this psychrophilic organism is of particular interest because it functions in extreme cold environments, making it valuable for comparative studies with mesophilic counterparts. The enzyme catalyzes electron transfer from NADH to quinone coupled with proton pumping across the cytoplasmic membrane, serving as the first enzyme in the respiratory chain . Understanding the cold-adapted properties of this complex may provide insights into energy transduction mechanisms under extreme conditions and reveal novel structural adaptations.

What is the structural organization of the nuoK subunit in Psychrobacter arcticus NDH-1?

The nuoK subunit (counterpart of the mitochondrial ND4L subunit) is the smallest subunit of NDH-1 in Psychrobacter arcticus. Structurally, it spans the membrane with three linearly arranged α-helices (TM1, TM2, and TM3) connected by short loops . According to three-dimensional structural models, the subunit has extensive interaction with the NuoN subunit, with its C-terminus extending between NuoN and helix HL (an α-helix of NuoL that spans multiple subunits in the membrane domain) . The protein contains two conserved glutamic acid residues (Glu-36 in TM2 and Glu-72 in TM3) that are critical for the energy-coupled activity of NDH-1 . The subunit also features a short cytoplasmic loop (containing Arg-25, Arg-26, and Asn-27) between TM1 and TM2 that plays a significant role in the enzyme's activity .

What are the recommended protocols for heterologous expression of recombinant Psychrobacter arcticus nuoK?

For optimal heterologous expression of recombinant P. arcticus nuoK, a multi-step approach is recommended:

  • Vector selection: Use expression vectors with cold-inducible promoters to accommodate the psychrophilic nature of the protein. The pET system with T7 promoter modified for lower temperature expression has shown good results.

  • Host strain optimization: E. coli C41(DE3) or C43(DE3) strains are preferable for membrane protein expression, as they are designed to accommodate potentially toxic membrane proteins.

  • Expression conditions:

    • Initial culture growth at 30°C until OD600 reaches 0.6-0.8

    • Temperature reduction to 16-18°C before induction

    • Induction with low IPTG concentrations (0.1-0.3 mM)

    • Extended expression period (18-24 hours) at 16°C

  • Membrane fraction isolation: Utilize differential centrifugation following cell lysis to isolate membrane fractions containing the integrated nuoK protein.

  • Protein solubilization: Use mild detergents such as DDM (n-dodecyl β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) for membrane protein extraction.

Expression of nuoK alone may result in inclusion bodies or improper folding; therefore, co-expression with other NDH-1 subunits, particularly those with which nuoK directly interacts (like nuoN), may improve proper folding and membrane integration.

How can researchers effectively measure the activity of recombinant Psychrobacter arcticus nuoK in experimental settings?

Activity analysis of Psychrobacter arcticus nuoK should be performed as part of the NDH-1 complex, as the isolated subunit does not possess independent catalytic activity. The following methods are recommended based on established protocols :

  • dNADH-K3Fe(CN)6 reductase activity assay:

    • Sample preparation: 80 μg of membrane protein/ml in 10 mM potassium phosphate (pH 7.0), 1 mM EDTA containing 10 mM KCN, and 1 mM K3Fe(CN)6

    • Preincubation: 1 minute at 30°C

    • Reaction initiation: Addition of 150 μM dNADH

    • Monitoring: Absorbance decrease at 420 nm (ε420 = 1.00 mM−1 cm−1)

  • dNADH-DB (decylubiquinone) reductase activity assay:

    • Similar buffer conditions as above, replacing K3Fe(CN)6 with 50 μM DB

    • Monitoring: Absorbance decrease at 340 nm (ε340 = 6.22 mM−1 cm−1)

  • dNADH-UQ1 (ubiquinone-1) reductase activity assay:

    • Same conditions as above, using 50 μM UQ1 instead of DB

    • Specificity confirmation: Addition of capsaicin-40 as an inhibitor

  • Proton pumping activity measurement:

    • ACMA (9-amino-6-chloro-2-methoxyacridine) fluorescence quenching assay

    • Preparation: Membrane vesicles in appropriate buffer

    • Initiation: Addition of 200 μM dNADH as substrate

    • Detection: Monitoring fluorescence quenching as indicator of proton translocation

For comparative analysis, perform these assays at different pH values (6.0-8.0) and temperatures (4-30°C) to capture the psychrophilic properties of the enzyme.

How do mutations in conserved residues of Psychrobacter arcticus nuoK affect enzyme function?

Studies on conserved residues in the nuoK subunit, based on homology with systems described in search result #4, reveal critical structure-function relationships:

  • Glutamic acid residues in transmembrane helices:

    • Glu-36 in TM2: Mutation to alanine (E36A) or glutamine (E36Q) results in almost complete abolishment of energy-transducing NDH-1 activities . This highlights its essential role in the coupling mechanism.

    • Glu-72 in TM3: Mutations (E72A, E72Q) cause partial but significant loss of activities , indicating an important but potentially less critical role than Glu-36.

  • Positional importance of Glu-36:

    • Shifting Glu-36 along TM2 to positions 32, 38, 39, and 40 allows retention of significant energy-transducing activities . This suggests the functional importance lies in maintaining a carboxylate group within the same helical face rather than at a specific amino acid position.

  • Cytoplasmic loop residues:

    • The double mutation of arginine residues (R25A/R26A) in the short loop connecting TM1 and TM2 drastically reduces electron transfer rates and diminishes electrochemical gradient formation . This indicates the importance of this positively charged loop in the proton translocation mechanism.

MutationElectron Transfer ActivityProton PumpingResearch Significance
E36A/QSeverely impairedNoneCritical coupling residue
E72A/QModerately reducedReducedSupporting role in energy coupling
R25A/R26AGreatly reducedDiminishedImportant for architecture and coupling
E36 positional shiftsLargely retainedRetainedHelical face positioning more important than exact location

These findings suggest that the conserved residues in nuoK participate directly or indirectly in the coupling mechanism of NDH-1, likely in conjunction with neighboring subunits.

What is known about the proton translocation mechanism involving Psychrobacter arcticus nuoK?

The proton translocation mechanism involving nuoK in Psychrobacter arcticus, based on structural studies and mutagenesis experiments, appears to involve several key features:

  • Transmembrane carboxyl residues: The conserved glutamic acids (Glu-36 in TM2 and Glu-72 in TM3) are positioned in adjacent transmembrane helices and likely participate in proton transfer pathways . The specific positioning of these residues on the same side of the membrane domain suggests they may form part of a proton channel or participate in a proton relay system.

  • Cytoplasmic loop contribution: The short cytoplasmic loop containing Arg-25 and Arg-26 between TM1 and TM2 appears to have functional significance in energy coupling . These positively charged residues may influence the local electrostatic environment, potentially affecting proton movement or protein conformational changes associated with energy transduction.

  • Subunit interactions: NuoK shows extensive interaction with the NuoN subunit, with its C-terminus extending between NuoN and helix HL of NuoL . This structural arrangement suggests that conformational changes in nuoK may be transmitted to adjacent subunits as part of the coupling mechanism.

  • Evolutionary connections: The nuoK subunit shows sequence similarity to the MrpC subunit of multisubunit Na+/H+ antiporters , though the key glutamate residues are not conserved in MrpC. This evolutionary relationship suggests that despite functional divergence, the basic mechanism may involve similar structural elements for ion translocation.

Current models propose that the energy released during electron transfer from NADH to quinone induces conformational changes that are transmitted through the membrane domain, including nuoK, resulting in proton translocation across the membrane. The exact pathway and molecular details await further elucidation through advanced structural studies of the Psychrobacter arcticus enzyme.

How does Psychrobacter arcticus nuoK differ from homologous subunits in mesophilic bacteria?

Psychrobacter arcticus nuoK, as a component of a psychrophilic enzyme complex, displays several distinctive features compared to its mesophilic counterparts:

  • Amino acid composition: Although the key functional residues (Glu-36, Glu-72) are conserved across species , psychrophilic nuoK likely contains:

    • Higher proportion of glycine residues providing conformational flexibility

    • Fewer proline residues reducing structural rigidity

    • Reduced hydrophobic core packing enabling greater flexibility at low temperatures

    • Potentially more polar surface residues improving solvent interactions at low temperatures

  • Structural flexibility: Cold-adapted enzymes typically display increased structural flexibility, particularly around catalytic sites. In nuoK, this may manifest as:

    • Less rigid transmembrane helices with potentially altered tilt angles

    • More dynamic loop regions, especially the cytoplasmic loop containing Arg-25 and Arg-26

    • Modified helix-helix packing interactions with adjacent subunits

  • Functional parameters: Comparative enzyme kinetics would likely reveal:

    • Lower activation energy for conformational changes associated with proton translocation

    • Higher catalytic efficiency (kcat/Km) at low temperatures

    • Lower thermal stability but enhanced activity preservation at cold temperatures

    • Different pH optimum profiles reflecting adaptation to cold environments

  • Protein-lipid interactions: The membrane-embedded nature of nuoK suggests adaptations in:

    • Interface residues that interact with cold-adapted membrane lipids in Psychrobacter arcticus

    • Modified hydrophobic matching between transmembrane segments and the thinner psychrophilic membrane

These differences reflect evolutionary adaptations that allow Psychrobacter arcticus NDH-1 to function efficiently in permanently cold environments while maintaining the core mechanistic features required for proton-coupled electron transfer.

What insights can be gained from comparing Psychrobacter arcticus nuoK with its mitochondrial counterpart (ND4L)?

Comparative analysis of bacterial Psychrobacter arcticus nuoK with its mitochondrial counterpart ND4L provides valuable evolutionary and functional insights:

  • Evolutionary conservation:

    • NuoK is the bacterial counterpart of the mitochondrial ND4L subunit , reflecting the endosymbiotic origin of mitochondria

    • Key functional residues (particularly Glu-36 in TM2) are conserved between bacterial and mitochondrial versions, suggesting fundamental mechanistic conservation

  • Structural variations:

    • Mitochondrial ND4L typically contains additional sequence elements reflecting eukaryotic adaptation

    • The supramolecular organization differs, with mitochondrial Complex I forming supercomplexes with other respiratory chain components

    • The mitochondrial enzyme operates in a different lipid environment with distinct membrane properties

  • Disease implications:

    • Mutations in human ND4L are associated with mitochondrial disorders including Leber's hereditary optic neuropathy (LHON) and other respiratory chain deficiencies

    • Bacterial models, including cold-adapted systems like Psychrobacter arcticus, can provide structural and functional insights into the effects of pathogenic mutations

  • Functional differences:

    • Bacterial nuoK functions in diverse environmental conditions, including extreme cold in the case of Psychrobacter arcticus

    • Mitochondrial ND4L operates in the relatively stable environmental conditions of the eukaryotic cell

    • The coupling mechanism may have subtle differences reflecting these different operating environments

Through such comparative analyses, researchers can better understand both the conserved core mechanisms of respiratory complex I and the specialized adaptations that enable function in diverse environments and biological contexts.

What are the current challenges in structural characterization of Psychrobacter arcticus nuoK, and how might they be addressed?

Structural characterization of Psychrobacter arcticus nuoK faces several significant challenges:

  • Membrane protein crystallization barriers:

    • High hydrophobicity leading to aggregation

    • Detergent micelle interference with crystal contacts

    • Conformational heterogeneity

    Potential solutions:

    • Lipidic cubic phase (LCP) crystallization approaches

    • Antibody fragment-mediated crystallization to provide additional hydrophilic surfaces

    • Nanodiscs or amphipols as alternative membrane mimetics

  • Expression and purification challenges:

    • Low expression levels typical of membrane proteins

    • Potential toxicity to host cells

    • Maintaining protein stability during purification

    Potential solutions:

    • Fusion with stability-enhancing tags (e.g., SUMO, MBP)

    • Co-expression with chaperones or partner subunits

    • Cell-free expression systems optimized for membrane proteins

  • Cold-adapted protein instability:

    • Inherent structural flexibility of psychrophilic proteins causing instability during purification

    • Temperature sensitivity during handling

    Potential solutions:

    • Maintaining cold chain throughout purification

    • Engineering thermostable variants for structural studies

    • Rapid purification protocols to minimize exposure to destabilizing conditions

  • Complex subunit interactions:

    • NuoK functions as part of a multi-subunit complex

    • Isolated subunit may lack proper folding or stability

    Potential solutions:

    • Co-expression and co-purification with interacting subunits (particularly NuoN)

    • Utilizing cryo-electron microscopy for whole-complex structural studies

    • Membrane scaffold protein (MSP) nanodiscs to maintain native-like environment

  • Advanced methodological approaches:

    • Single-particle cryo-electron microscopy with improved detectors and processing algorithms

    • Integrative structural biology combining multiple techniques (X-ray crystallography, NMR, SAXS, cross-linking mass spectrometry)

    • Molecular dynamics simulations to model flexibility and conformational changes

By combining these approaches, researchers can work toward a comprehensive structural understanding of Psychrobacter arcticus nuoK in the context of the complete NDH-1 complex.

What bioinformatic approaches are most valuable for analyzing Psychrobacter arcticus nuoK sequence and predicting functional elements?

Multiple bioinformatic approaches provide valuable insights into Psychrobacter arcticus nuoK structure and function:

  • Sequence conservation analysis:

    • Multiple sequence alignment across diverse species identifies highly conserved residues (e.g., Glu-36, Glu-72)

    • Conservation mapping onto structural models identifies functionally important regions

    • Calculation of site-specific evolutionary rates using methods like Rate4Site

    Tools: Clustal Omega, MUSCLE, ConSurf

  • Transmembrane topology prediction:

    • Accurate prediction of the three transmembrane segments (TM1-3)

    • Identification of membrane-water interfaces and potential functional sites

    • Orientation determination relative to membrane planes

    Tools: TMHMM, TOPCONS, MEMSAT-SVM

  • Structural modeling approaches:

    • Homology modeling based on available Complex I structures

    • Ab initio modeling of poorly conserved regions

    • Refinement through molecular dynamics simulations in membrane environment

    Tools: AlphaFold2, RosettaMP, SWISS-MODEL

  • Functional site prediction:

    • Identification of potential proton pathways using cavity detection algorithms

    • Electrostatic surface mapping to identify potential proton translocation routes

    • Hydrogen bond network analysis to predict proton transfer pathways

    Tools: CAVER, HOLLOW, APBS, H++

  • Coevolution analysis:

    • Detection of coevolving residue pairs suggesting functional coupling

    • Prediction of residue contact maps to validate structural models

    • Identification of interaction interfaces with other subunits

    Tools: EVcouplings, RaptorX-Contact, GREMLIN

  • Molecular dynamics simulations:

    • Membrane-embedded simulations to study dynamics and stability

    • Potential of mean force calculations for proton movement

    • Conformational change analysis during simulated proton translocation

    Tools: GROMACS, NAMD, CHARMM-GUI

These computational approaches, used in combination, can generate testable hypotheses about nuoK function that guide experimental design and interpretation of results.

How might synthetic biology approaches be applied to engineer Psychrobacter arcticus nuoK for enhanced properties or novel applications?

Synthetic biology offers several promising approaches for engineering Psychrobacter arcticus nuoK:

  • Cold-active bioenergetic applications:

    • Engineering nuoK variants with enhanced stability while maintaining cold activity

    • Creation of chimeric proteins combining cold-adapted domains with mesophilic components

    • Development of minimal NDH-1 complexes containing engineered nuoK for biotechnological applications

  • Proton translocation engineering:

    • Modification of key residues (Glu-36, Glu-72) to alter proton specificity or efficiency

    • Engineering altered proton pathways to create pH-responsive energy transduction

    • Introduction of non-canonical amino acids at key positions to manipulate proton affinities

  • Reporter system development:

    • Creation of nuoK-fluorescent protein fusions for membrane potential sensing

    • Development of split-protein complementation assays based on nuoK interactions

    • Engineering allosteric switches into nuoK to create biosensors

  • Directed evolution approaches:

    • Creation of nuoK variant libraries with randomized transmembrane domains

    • Selection systems for enhanced activity at different temperatures

    • Continuous evolution systems to discover novel functional properties

  • Design strategies using multistate design:

    • Application of multistate design principles from NUPACK to optimize nuoK performance across multiple conditions

    • Multi-tube design ensembles to capture concentration and crosstalk effects

    • Engineering of dynamic hybridization cascades incorporating nuoK as a sensing element

These synthetic biology approaches could lead to the development of novel bioenergetic tools, sensors, and catalysts with applications in biotechnology and bioenergy.

What are the current hypotheses regarding the evolutionary history of Psychrobacter arcticus nuoK and its adaptation to cold environments?

Current evolutionary hypotheses regarding Psychrobacter arcticus nuoK include:

  • Cold adaptation mechanisms:

    • Gradual accumulation of flexibility-enhancing amino acid substitutions

    • Trade-off between structural stability and catalytic efficiency at low temperatures

    • Coevolution with cold-adapted membrane lipids in Psychrobacter arcticus

  • Evolutionary relationship with ion transporters:

    • NuoK shows sequence similarity to the MrpC subunit of multisubunit Na+/H+ antiporters

    • This suggests an evolutionary connection between respiratory complexes and ion transporters

    • The key glutamate residues (Glu-36, Glu-72) in nuoK are not conserved in MrpC , indicating functional divergence after gene duplication

  • Conservation patterns:

    • Perfect conservation of Glu-36 across species suggests an indispensable functional role

    • Near-perfect conservation of Glu-72 indicates important but potentially variable functions

    • Variable conservation of other residues reflects adaptation to specific environmental niches

  • Horizontal gene transfer considerations:

    • Psychrobacter species are known to carry plasmids that facilitate genetic exchange

    • This raises the possibility that some nuoK features may have been acquired through horizontal gene transfer

    • Comparative genomics between Psychrobacter strains shows variable genetic content

  • Adaptation signatures:

    • Analysis of nonsynonymous to synonymous substitution ratios (dN/dS) in nuoK sequences

    • Identification of positively selected sites that may contribute to cold adaptation

    • Comparison with homologs from other psychrophilic, mesophilic, and thermophilic organisms

These evolutionary hypotheses provide a framework for understanding how Psychrobacter arcticus nuoK has adapted to function efficiently in permanently cold environments while maintaining its core role in energy conservation.

What are the most common technical challenges when working with recombinant Psychrobacter arcticus nuoK, and how can they be addressed?

Researchers working with recombinant Psychrobacter arcticus nuoK commonly encounter these technical challenges:

By anticipating these challenges and implementing the suggested solutions, researchers can improve their chances of successful experimental outcomes when working with this challenging but scientifically valuable protein.

How should researchers design experiments to investigate the relationship between nuoK structure and proton translocation function in Psychrobacter arcticus?

Designing experiments to investigate structure-function relationships in Psychrobacter arcticus nuoK requires a multifaceted approach:

  • Site-directed mutagenesis strategy:

    • Systematic alanine scanning of transmembrane regions

    • Conservative and non-conservative substitutions of key residues (Glu-36, Glu-72)

    • Positional shifting of critical residues along transmembrane helices

    • Introduction of proton-sensitive fluorescent amino acids at strategic positions

    Experimental design considerations:

    • Include positive and negative controls (wild-type and known inactive mutants)

    • Prepare multiple biological replicates (n≥3)

    • Test activity under various conditions (pH, temperature, ionic strength)

  • Functional assays:

    • Couple electron transfer measurements with proton translocation assays

    • Design experiments to measure:

      • dNADH-K3Fe(CN)6 reductase activity (electron transfer)

      • dNADH-DB/UQ1 reductase activity (physiological electron acceptors)

      • Proton pumping (ACMA fluorescence quenching)

      • Membrane potential generation (voltage-sensitive dyes)

    Data analysis approaches:

    • Calculate kinetic parameters (Km, Vmax) at different temperatures

    • Determine activation energies (Arrhenius plots)

    • Analyze pH dependence to identify ionizable groups

  • Structural characterization:

    • Apply complementary techniques:

      • Crosslinking mass spectrometry to identify proximity relationships

      • Hydrogen-deuterium exchange mass spectrometry to probe dynamics

      • EPR spectroscopy with site-directed spin labeling to measure distances

      • Cryo-electron microscopy of intact complex

    Integration with functional data:

    • Correlate structural perturbations with functional outputs

    • Develop structure-based models of proton translocation

  • Reconstitution experiments:

    • Purify wild-type and mutant proteins for reconstitution

    • Prepare proteoliposomes with defined lipid composition

    • Measure proton translocation in the reconstituted system

    • Test complementation with other purified subunits

  • Computational-experimental integration:

    • Use molecular dynamics simulations to generate hypotheses

    • Design experiments to test computational predictions

    • Iteratively refine models based on experimental outcomes

  • Research planning framework:

    • Follow the deductive approach for hypothesis testing

    • Develop clear research questions that guide data collection

    • Use quantitative hypotheses to make specific predictions about relationships between variables

This comprehensive experimental design strategy will enable researchers to establish mechanistic connections between nuoK structural elements and proton translocation function in Psychrobacter arcticus.

What funding opportunities are specifically relevant for research on Psychrobacter arcticus nuoK and similar cold-adapted energy-transducing systems?

Researchers investigating Psychrobacter arcticus nuoK can pursue several targeted funding opportunities:

  • National Institutes of Health (NIH):

    • NIGMS Research Project Grants (R01) focused on fundamental bioenergetic mechanisms

    • NIGMS Maximizing Investigators' Research Award (MIRA) for established investigators

    • NIH Exploratory/Developmental Research Grant Award (R21) for high-risk, high-reward studies

    • Training grants requiring specific data tables as outlined in NIH guidance

  • National Science Foundation (NSF):

    • Division of Molecular and Cellular Biosciences (MCB) grants

    • Dimensions of Biodiversity program for studies of extremophile adaptations

    • Integrative Research in Biology (IntBIO) for multidisciplinary approaches

    • Antarctic research programs focusing on cold adaptation mechanisms

  • Department of Energy (DOE):

    • Biological and Environmental Research (BER) program

    • Basic Energy Sciences (BES) program for fundamental studies of energy transduction

    • Bioenergy Research Centers focusing on novel bioenergetic systems

  • International opportunities:

    • European Research Council (ERC) grants for innovative research

    • Human Frontier Science Program (HFSP) for international collaborations

    • JSPS (Japan) bilateral programs for collaborative research

  • Foundation and society grants:

    • American Society for Microbiology research fellowships

    • Life Sciences Research Foundation postdoctoral fellowships

    • Simons Foundation grants for fundamental biological mechanisms

When preparing applications, researchers should:

  • Highlight the unique aspects of cold-adapted energy transduction systems

  • Emphasize potential biotechnological applications

  • Address broader impacts related to climate change and extreme environments

  • Include preliminary data demonstrating feasibility

  • Prepare required institutional data tables according to specific funding agency requirements

What resources and collaboration opportunities exist for researchers studying Psychrobacter arcticus nuoK?

Researchers studying Psychrobacter arcticus nuoK can leverage several resources and collaboration opportunities:

  • Biological materials and datasets:

    • Type strain Psychrobacter arcticus 273-4 available from culture collections (ATCC, DSMZ)

    • Genome sequence data accessible through NCBI (complete genome sequencing)

    • Proteomic datasets from mass spectrometry repositories

    • Structural data of related complexes from Protein Data Bank (PDB)

  • Specialized research facilities:

    • Synchrotron facilities for advanced structural studies

    • Cryo-electron microscopy centers

    • National laboratories with specialized equipment for biophysical characterization

    • Advanced mass spectrometry facilities for protein analysis

  • Collaborative networks:

    • International extremophile research consortia

    • Bioenergetics research networks

    • Cold adaptation research communities

    • Structural biology consortia focused on membrane proteins

  • Computational resources:

    • High-performance computing facilities for molecular dynamics simulations

    • Specialized software for membrane protein modeling

    • Bioinformatic pipelines for evolutionary analysis

    • NUPACK design tools for complex biological system engineering

  • Training opportunities:

    • Specialized workshops on membrane protein biochemistry

    • Courses on advanced structural biology techniques

    • Bioinformatics training for sequence analysis

    • NIH-supported training programs with specific data reporting requirements

  • Industry partnerships:

    • Biotechnology companies interested in cold-active enzymes

    • Pharmaceutical companies seeking novel antimicrobial targets

    • Bioenergy firms exploring alternative energy transduction systems

    • Biosensor developers interested in cold-adapted sensing elements

By leveraging these resources and forming strategic collaborations, researchers can overcome technical challenges and accelerate discovery in this specialized field.

What are the major unanswered questions about Psychrobacter arcticus nuoK that represent high-priority research opportunities?

Several critical questions about Psychrobacter arcticus nuoK remain unanswered, presenting significant research opportunities:

Addressing these questions will not only advance our understanding of this specific system but will also provide broader insights into bioenergetic adaptation to extreme environments.

How might research on Psychrobacter arcticus nuoK contribute to broader scientific knowledge and applications?

Research on Psychrobacter arcticus nuoK has far-reaching implications across multiple scientific domains:

  • Fundamental bioenergetics:

    • Insights into the core mechanisms of proton-coupled electron transfer

    • Understanding of structure-function relationships in respiratory complexes

    • Elucidation of evolutionary relationships between different ion-translocating systems

  • Extremophile adaptation mechanisms:

    • Principles of protein adaptation to extreme cold

    • Understanding of energy conservation strategies in harsh environments

    • Insights into evolutionary pathways for environmental adaptation

  • Biomedical applications:

    • Comparison with human mitochondrial ND4L could provide insights into mitochondrial diseases

    • Understanding bacterial energy conservation systems could reveal new antimicrobial targets

    • Insights into weak TLR4-mediated inflammatory responses induced by P. arcticus LPS could inform immunological research

  • Biotechnological innovations:

    • Development of cold-active biocatalysts for industrial applications

    • Engineering of energy-transducing systems with novel properties

    • Creation of biosensors that function at low temperatures

    • Design of minimal synthetic biological systems for specialized applications

  • Environmental and astrobiological significance:

    • Understanding microbial adaptation to permanently cold environments on Earth

    • Insights relevant to potential life in cold extraterrestrial environments

    • Contribution to knowledge of microbial survival in a changing climate

  • Methodological advances:

    • Development of improved techniques for membrane protein characterization

    • Refinement of computational approaches for modeling ion translocation

    • Advancement of biochemical methods for studying low-temperature enzyme function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.