Recombinant Psychrobacter arcticus UPF0060 membrane protein Psyc_0916 (Psyc_0916)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary by purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Psyc_0916; UPF0060 membrane protein Psyc_0916
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Psychrobacter arcticus (strain DSM 17307 / 273-4)
Target Names
Psyc_0916
Target Protein Sequence
MSELKTVGLFAITALAEIAGCYLPYLWLREGKSIWLLIPGALSLVAFVWLLSLHPTAAGR TYAAYGGVYISMAILWLWTVNGIRPTTWDIVGSVVALIGMAIIMFAPRSV
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is recombinant Psyc_0916 protein typically produced and purified for research applications?

Recombinant Psyc_0916 is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification. The full-length protein (amino acids 1-110) is expressed heterologously and purified using affinity chromatography. The purified protein is commonly supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE analysis. For reconstitution, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and glycerol (final concentration 5-50%) can be added for long-term storage .

What are the optimal storage conditions for maintaining the stability of recombinant Psyc_0916 protein?

For optimal stability, recombinant Psyc_0916 should be stored at -20°C or -80°C after reconstitution, with aliquoting recommended to prevent multiple freeze-thaw cycles. The protein is typically supplied in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, or in a Tris-based buffer with 50% glycerol optimized for this specific protein. For short-term use, working aliquots can be stored at 4°C for up to one week. Repeated freezing and thawing should be avoided as it can lead to protein denaturation and loss of biological activity .

What methods are most effective for studying the membrane topology and integration of Psyc_0916?

To study the membrane topology and integration of Psyc_0916, researchers should consider a multi-faceted approach:

  • Computational prediction: Begin with in silico analysis using transmembrane prediction tools like TMHMM, HMMTOP, or Phobius to predict membrane-spanning regions.

  • Cysteine scanning mutagenesis: Systematically replace residues with cysteine and then use membrane-impermeable thiol-reactive reagents to identify exposed regions.

  • Fusion protein approaches: Create fusions with reporter proteins (GFP or alkaline phosphatase) at various positions to determine orientation relative to the membrane.

  • Protease protection assays: Use proteases to digest exposed regions while membrane-embedded regions remain protected.

  • Cryo-electron microscopy: For higher resolution structural information, particularly relevant for cold-adapted membrane proteins from psychrophilic organisms like P. arcticus.

The combination of these approaches would provide complementary data on the protein's membrane topology, especially important given the cold adaptation features of proteins from P. arcticus .

How can researchers effectively reconstitute Psyc_0916 into lipid bilayers for functional studies?

For functional reconstitution of Psyc_0916 into lipid bilayers, researchers should follow this methodological approach:

  • Initial protein preparation: Reconstitute the lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL concentration, ensuring complete solubilization.

  • Lipid selection: Choose lipid compositions that mimic the native membrane environment of P. arcticus, considering its cold adaptation. Mixtures containing higher proportions of unsaturated lipids would better replicate the cold-adapted membrane fluidity.

  • Reconstitution method: Employ either detergent-mediated reconstitution using mild detergents (e.g., DDM or CHAPS) followed by detergent removal via dialysis or Bio-Beads, or use direct incorporation into preformed liposomes.

  • Verification of incorporation: Confirm successful reconstitution using freeze-fracture electron microscopy, dynamic light scattering, or density gradient centrifugation.

  • Functional assays: Design assays based on hypothesized functions, potentially including ion transport, substrate binding, or protein-protein interactions at varying temperatures (especially low temperatures between -10°C and 10°C) to reflect the psychrophilic nature of P. arcticus .

How does the amino acid composition of Psyc_0916 reflect adaptations to cold environments?

Analysis of Psyc_0916's amino acid composition reveals characteristic cold-adaptation features that align with the broader proteome adaptations observed in Psychrobacter arcticus:

  • Reduced acidic amino acid content: Like other proteins in the P. arcticus proteome, Psyc_0916 shows reduced usage of acidic amino acids (aspartic acid and glutamic acid) compared to mesophilic homologs.

  • Lower proline and arginine content: The protein contains fewer proline and arginine residues, which typically contribute to structural rigidity in proteins.

  • Increased glycine and small hydrophobic residues: There is a higher proportion of glycine and small hydrophobic amino acids that promote increased structural flexibility at low temperatures.

  • Membrane compatibility: As a membrane protein, Psyc_0916 contains hydrophobic regions compatible with the more fluid membrane composition that P. arcticus maintains at low temperatures.

These adaptations collectively contribute to maintaining protein flexibility and function at the extremely low temperatures (-10°C to -12°C) of the Siberian permafrost environment from which P. arcticus was isolated .

What experimental approaches can determine the temperature-dependent functional characteristics of Psyc_0916?

To determine the temperature-dependent functional characteristics of Psyc_0916, researchers should employ a range of biophysical and biochemical methods:

  • Circular dichroism (CD) spectroscopy: Monitor secondary structure changes across a temperature range (ideally -10°C to 37°C) to assess thermal stability and potential cold-induced conformational changes.

  • Differential scanning calorimetry (DSC): Measure the protein's thermal transition points and compare with mesophilic homologs to quantify cold adaptation.

  • Temperature-dependent activity assays: Once a putative function is identified, perform activity measurements at various temperatures to establish temperature optima and thermal stability profiles.

  • Fluorescence-based thermal shift assays: Assess protein stability across temperatures using fluorescent dyes that bind to hydrophobic regions exposed during unfolding.

  • Hydrogen-deuterium exchange mass spectrometry: Compare protein dynamics and flexibility at different temperatures to identify regions with enhanced flexibility at low temperatures.

  • In vivo complementation studies: Express Psyc_0916 in a mesophilic host at various temperatures to assess functional complementation and temperature-dependent phenotypes .

What are the proposed functions of UPF0060 family membrane proteins, and how can they be experimentally validated for Psyc_0916?

The UPF0060 family of membrane proteins has limited functional characterization, but several approaches can be used to elucidate Psyc_0916's function:

  • Comparative genomics: Analyze the genomic context of Psyc_0916 within the P. arcticus genome to identify potentially co-regulated genes or operons that might suggest functional relationships.

  • Structural prediction and modeling: Use AlphaFold or similar tools to predict the structure and identify potential binding pockets or functional domains.

  • Gene knockout/complementation: Generate a knockout in P. arcticus or a heterologous host, characterize the resulting phenotype, and verify through complementation studies.

  • Protein-protein interaction studies: Perform pull-down assays, bacterial two-hybrid screens, or cross-linking experiments to identify interaction partners that may suggest function.

  • Metabolomic profiling: Compare metabolites in wild-type and knockout strains to identify potential substrates or pathways affected by Psyc_0916.

Based on the characteristics of cold-adapted organisms and membrane proteins, potential functions might include roles in membrane fluidity regulation, solute transport, stress response, or signal transduction specifically adapted to function at low temperatures .

How does the expression of Psyc_0916 change under various stress conditions in Psychrobacter arcticus?

To study expression changes of Psyc_0916 under stress conditions in P. arcticus, researchers should employ the following methodological approach:

  • RNA isolation protocol optimization:

    • Use specialized RNA extraction methods for psychrophilic bacteria

    • Perform extraction at low temperatures to prevent RNA degradation

    • Consider RNAprotect or similar stabilization solutions optimized for cold conditions

  • Quantitative PCR (qPCR) analysis:

    • Design primers specific to Psyc_0916

    • Use reference genes validated for stability under cold stress

    • Conduct expression analysis under various conditions:

      • Temperature shifts (-10°C to 22°C)

      • Osmotic stress

      • Oxidative stress

      • Nutrient limitation

      • Freeze-thaw cycles

  • RNA-seq analysis:

    • Perform global transcriptome analysis to place Psyc_0916 in the context of genome-wide expression changes

    • Compare expression patterns with other cold-shock proteins and membrane components

  • Protein-level verification:

    • Develop antibodies against Psyc_0916 or use epitope tagging

    • Perform Western blots to confirm transcript-level changes translate to protein levels

    • Consider proteomics approaches to quantify relative abundance under different conditions

This comprehensive approach would provide insights into the role of Psyc_0916 in stress response pathways, particularly those relevant to cold adaptation .

How does Psyc_0916 compare to homologous proteins in mesophilic bacteria, and what insights does this provide about cold adaptation?

Comparative analysis between Psyc_0916 and its mesophilic homologs reveals several key differences that contribute to cold adaptation:

FeaturePsyc_0916 (Psychrophile)Mesophilic HomologsFunctional Implication
Acidic amino acid contentReducedHigherDecreased surface charge, increased flexibility
Proline contentLowerHigherReduced structural rigidity
Arginine contentLowerHigherFewer stabilizing ionic interactions
Hydrophobic coreLess compactMore compactEnhanced internal flexibility
Surface hydrophobicitySlightly increasedLowerBetter interaction with fluid membranes
Glycine contentHigherLowerIncreased backbone flexibility

These differences reflect evolutionary adaptations that allow Psyc_0916 to maintain flexibility and function at extremely low temperatures. The modifications in amino acid usage occurred in response to the long-term freezing temperatures (-10°C to -12°C) of the Siberian permafrost from which P. arcticus was isolated. These adaptations are particularly important for membrane proteins like Psyc_0916, which must remain functional in the more fluid membrane environment that psychrophilic bacteria maintain at low temperatures .

What research approaches can reveal the evolutionary history of Psyc_0916 and related UPF0060 family proteins across temperature-diverse bacterial species?

To investigate the evolutionary history of Psyc_0916 and related UPF0060 family proteins, researchers should employ a multi-faceted phylogenetic approach:

  • Comprehensive sequence collection:

    • Gather UPF0060 family sequences from diverse bacterial species spanning psychrophiles, mesophiles, and thermophiles

    • Include sequences from closely related Psychrobacter species and other cold-adapted genera

    • Search for homologs in ancient permafrost metagenomes to assess evolutionary stability

  • Phylogenetic reconstruction:

    • Construct multiple sequence alignments using MUSCLE or MAFFT

    • Generate maximum likelihood and Bayesian phylogenetic trees

    • Perform reconciliation analysis with species trees to identify potential horizontal gene transfer events

  • Selection analysis:

    • Calculate dN/dS ratios to identify sites under positive selection

    • Use branch-site models to detect lineage-specific selective pressures

    • Compare selection patterns between psychrophilic and non-psychrophilic lineages

  • Ancestral sequence reconstruction:

    • Infer ancestral sequences at key nodes in the phylogeny

    • Express and characterize reconstructed proteins to assess functional evolution

    • Examine the progressive acquisition of cold-adaptive traits

  • Structural comparison:

    • Map sequence changes onto predicted or determined structures

    • Identify structural elements most affected by adaptation to different temperature niches

    • Correlate structural features with functional capabilities across temperature ranges

This approach would provide insights into how UPF0060 family proteins adapted to different thermal environments and the specific evolutionary trajectory of Psyc_0916 in the cold-adapted P. arcticus genome .

How can Psyc_0916 be leveraged in protein engineering applications requiring low-temperature functionality?

Psyc_0916 offers valuable insights for protein engineering applications requiring low-temperature functionality through several strategic approaches:

  • Domain swapping experiments:

    • Exchange domains between Psyc_0916 and mesophilic homologs to identify critical cold-adaptive regions

    • Create chimeric proteins with enhanced low-temperature activity while maintaining stability

    • Test functionality across temperature ranges to optimize performance windows

  • Directed evolution strategies:

    • Develop selection systems optimized for low-temperature screening

    • Apply error-prone PCR to generate Psyc_0916 variant libraries

    • Select for improved folding, stability, or activity at target low temperatures

  • Structure-guided rational design:

    • Identify and modify rigidity-conferring residues based on Psyc_0916's adaptations

    • Introduce flexibility-enhancing substitutions at strategic positions

    • Optimize surface charge distribution to maintain solubility at low temperatures

  • Cold-active membrane protein expression systems:

    • Develop P. arcticus-based expression systems for challenging membrane proteins

    • Optimize cold-inducible promoters for controlled expression

    • Engineer membrane composition to better accommodate target proteins

  • Biotechnological applications:

    • Design biosensors functional at low temperatures

    • Develop biocatalysts for cold-environment remediation

    • Create stable protein scaffolds for low-temperature industrial processes

These approaches leverage the natural cold adaptations of Psyc_0916 to advance protein engineering for applications ranging from biocatalysis in cold environments to improved cold-chain biologics stability .

What methodological challenges exist when studying membrane proteins from psychrophilic organisms, and how can they be addressed?

Studying membrane proteins from psychrophilic organisms like P. arcticus presents several unique methodological challenges that require specialized approaches:

  • Expression system optimization:

    • Challenge: Standard expression systems often operate at temperatures incompatible with proper folding of psychrophilic proteins

    • Solution: Develop cold-adapted expression hosts or use temperature-downshift protocols in traditional systems; consider psychrophilic expression systems based on Antarctic yeasts or Arctic bacteria

  • Membrane mimetic selection:

    • Challenge: Conventional membrane mimetics may not replicate the unique lipid composition of psychrophilic membranes

    • Solution: Formulate lipid mixtures with higher unsaturated fatty acid content and branched-chain lipids that better mimic cold-adapted membranes; consider nanodisc systems with customized lipid compositions

  • Protein stability during purification:

    • Challenge: Cold-adapted proteins often show reduced stability during purification at ambient temperatures

    • Solution: Perform all purification steps at reduced temperatures (4°C or lower); use thermostated systems and cold-room facilities; minimize time between purification steps

  • Structural determination challenges:

    • Challenge: Inherent flexibility of cold-adapted proteins complicates crystallization

    • Solution: Employ cryo-EM methods optimized for flexible proteins; use X-ray free-electron laser (XFEL) crystallography with microcrystals; consider stabilizing ligands during crystallization attempts

  • Functional assay temperature control:

    • Challenge: Maintaining precise subzero temperatures without freezing buffers during functional assays

    • Solution: Use antifreeze additives in assay buffers; develop specialized low-temperature assay equipment; employ temperature-controlled microfluidic systems

  • Data interpretation complexities:

    • Challenge: Distinguishing cold-specific adaptations from general evolutionary features

    • Solution: Always include appropriate mesophilic controls; perform comparative studies across temperature ranges; use comprehensive bioinformatic analyses to identify cold-specific signatures

Addressing these challenges requires a multidisciplinary approach combining expertise in membrane biochemistry, cryobiology, and psychrophilic microbiology to effectively study proteins like Psyc_0916 .

What insights does the genomic context of the Psyc_0916 gene provide about its potential function and regulation?

The genomic context analysis of the Psyc_0916 gene in the P. arcticus genome can provide valuable insights into its function and regulation:

  • Operon structure and co-transcribed genes:

    • Identification of genes co-transcribed with Psyc_0916 can suggest functional relationships

    • Presence of polycistronic mRNAs containing Psyc_0916 would indicate coordinated expression with functionally related proteins

  • Regulatory elements:

    • Analysis of the promoter region may reveal binding sites for cold-shock responsive transcription factors

    • Identification of riboswitch elements or other post-transcriptional regulatory structures could indicate regulation by specific metabolites or environmental conditions

  • Genomic neighborhood analysis:

    • Examination of adjacent genes can reveal functional associations through conserved genomic proximity

    • Comparison of this genomic context across Psychrobacter species and other cold-adapted bacteria can identify conserved gene clusters

  • Comparative genomics with related species:

    • Analysis of synteny (conserved gene order) across different bacterial species can highlight functionally important associations

    • Identification of gene fusion events involving Psyc_0916 homologs in other species may suggest functional relationships

  • Mobile genetic elements:

    • Presence or absence of nearby transposons, IS elements, or phage genes could indicate whether Psyc_0916 was horizontally acquired

    • The P. arcticus genome contains 48 transposons or insertion sequence elements and 25 phage-related genes, which have contributed to genome evolution

The 2.65-Mb genome of P. arcticus has a relatively stable structure, as indicated by GC skew analysis, despite the organism being naturally transformable. This suggests that Psyc_0916 is likely part of the core genome that has been under selective pressure for cold adaptation rather than a recently acquired element .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.