Recombinant Psychrobacter cryohalolentis ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Psychrobacter cryohalolentis ATP Synthase Subunit b (atpF)

Recombinant Psychrobacter cryohalolentis ATP synthase subunit b (atpF) is a purified protein derived from the psychrotolerant bacterium Psychrobacter cryohalolentis strain K5. This subunit is a critical component of the F₀ sector in ATP synthase, a membrane-bound enzyme responsible for proton-driven ATP synthesis in bacteria. The recombinant form is engineered for use in biochemical assays, structural studies, and immunological applications.

Key characteristics (based on commercial data ):

ParameterDetails
Source organismPsychrobacter cryohalolentis strain K5 (psychrotolerant)
Uniprot IDQ1Q895
Tag infoDetermined during production (no specific tag disclosed)
StorageTris-based buffer, 50% glycerol, stored at -20°C
UsageResearch applications (ELISA, structural studies, biochemical assays)

Functional Role

Subunit b plays a non-catalytic role in ATP synthase, primarily stabilizing the F₀F₁ complex. Mutations in this subunit often disrupt ATP synthesis or proton translocation efficiency . In psychrophiles like P. cryohalolentis, subunit b may exhibit adaptations to maintain membrane fluidity and enzymatic activity at low temperatures.

Immunological Studies

Recombinant subunit b is used in ELISA kits to detect antibodies specific to ATP synthase subunits. This application leverages the protein’s conserved epitopes for immunological profiling .

Psychrophilic Adaptations

P. cryohalolentis thrives in permafrost environments, requiring cold-adapted enzymes. Transcriptome analyses of related psychrophiles (e.g., Psychrobacter arcticus) reveal downregulated ATP synthase expression at low temperatures, prioritizing energy conservation . Subunit b’s role in this context remains understudied but may involve stabilizing membrane integrity under freezing conditions.

Sequence and Biochemical Properties

The recombinant subunit b (atpF) from P. cryohalolentis K5 has a predicted sequence of 156 amino acids (AA 1–156) . Key sequence motifs include:

PositionResidue SequenceFunctional Relevance
1–156MNINSTLIGQAIAFAIFVMFCMKFVWPPLIGAINDRQRKIAEGLNAAEKAKADLATAERDVQQELDLAKTKAAALIEQANKSANQLVEDAKSQAQVEGERIRQQAQASIDQEINQARESLRAQVAELAVLGAEKILQDKVDVQKHASmLDQLAAKLPutative binding sites for subunit a and proton translocation

Note: The sequence includes hydrophobic regions (e.g., transmembrane helices) and conserved residues critical for subunit interactions.

Challenges and Future Directions

  1. Limited Structural Data: High-resolution structures of P. cryohalolentis ATP synthase are unavailable, necessitating comparative modeling with homologs .

  2. Cold-Adaptation Mechanisms: The role of subunit b in maintaining ATP synthase activity at subzero temperatures requires further investigation.

  3. Applications in Biotechnology: Psychrophilic ATP synthases could inspire novel bioenergetic systems for cold environments.

References and Data Sources

  1. Commercial Product Specifications

  2. Structural Biology of Bacterial ATP Synthases

  3. Psychrophilic Survival Mechanisms

  4. Enzyme Characterization in Psychrobacter

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
atpF; Pcryo_2331; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Psychrobacter cryohalolentis (strain K5)
Target Names
atpF
Target Protein Sequence
MNINSTLIGQAIAFAIFVMFCMKFVWPPLIGAINDRQRKIAEGLNAAEKAKADLATAERD VQQELDLAKTKAAALIEQANKSANQLVEDAKSQAQVEGERIRQQAQASIDQEINQARESL RAQVAELAVLGAEKILQDKVDVQKHASMLDQLAAKL
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core; and the F0 domain, encompassing the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 to F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Psychrobacter cryohalolentis ATP synthase subunit b (atpF) and what is its role in cellular metabolism?

Psychrobacter cryohalolentis ATP synthase subunit b (atpF) is a critical component of the F-type ATP synthase complex found in this psychrophilic bacterium. ATP synthase is a unique macromolecular rotary machine of approximately 625 kDa that catalyzes the final step in oxidative phosphorylation . The atpF gene encodes subunit b, which forms part of the membrane-embedded F₀ domain and peripheral stalk, connecting the catalytic head with the membrane stator .

Specifically, subunit b (atpF) in P. cryohalolentis is a 156-amino acid protein with the ordered locus name Pcryo_2331 . It functions as part of the stationary component of ATP synthase that harnesses the proton motive force (pmf) across the membrane to drive ATP synthesis. This protein plays a crucial role in the remarkable ability of P. cryohalolentis to maintain metabolic activity at extremely low temperatures, even as low as -80°C .

How should recombinant P. cryohalolentis ATP synthase subunit b be stored and handled for optimal experimental results?

For optimal experimental outcomes when working with recombinant P. cryohalolentis ATP synthase subunit b, follow these research-validated storage and handling protocols:

  • Store stock protein at -20°C for regular usage, or at -80°C for extended storage

  • Maintain the protein in Tris-based buffer with 50% glycerol optimized for protein stability

  • Avoid repeated freeze-thaw cycles as this significantly decreases protein stability and activity

  • For ongoing experiments, store working aliquots at 4°C for up to one week

  • When reconstituting lyophilized protein, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Consider adding glycerol to a final concentration of 5-50% for long-term storage solutions

These conditions have been established to maintain the structural integrity and functional properties of the protein, particularly important for a psychrophilic enzyme that may be sensitive to temperature fluctuations.

How does ATP synthase activity in P. cryohalolentis adapt to extremely low temperatures and what experimental approaches reveal these mechanisms?

P. cryohalolentis exhibits remarkable adaptations in its ATP synthase function at extremely low temperatures, as revealed through several sophisticated experimental approaches:

Physiological adaptations:

  • Cellular ATP and ADP concentrations increase significantly with decreasing temperature, with the most dramatic increases observed in frozen cell suspensions below -5°C

  • This temperature-dependent response requires a functioning proton motive force, as demonstrated by experiments with respiratory uncouplers

  • Elevated adenylate levels develop rapidly (<1 hour) after freezing, suggesting this is an active adaptive response rather than passive accumulation

Experimental approaches to study these adaptations:

MethodParameters MeasuredKey Findings
Luciferase-based ATP assayATP concentration at 22°C to -80°CATP concentration increases up to 5-fold at lower temperatures
Enzyme-coupled ADP assayADP concentration at various temperaturesADP increases in parallel with ATP, indicating active metabolism
Respirometry with proton ionophoresEffect of uncoupling on adenylate levelsConfirmed requirement of proton motive force for ATP accumulation
Osmotic shock experimentsResponse to elevated solute concentrationSimulated conditions in ice fraction trigger similar ATP increase
Radiolabeled substrate incorporationMetabolic activity at sub-zero temperaturesP. cryohalolentis actively generates ATP at temperatures as low as -80°C

These findings suggest that increasing adenylate concentrations may be a strategy for offsetting the kinetic temperature effect, thereby maintaining metabolic reaction rates at low temperatures . This mechanistic understanding provides insight into how life can persist in permanently frozen environments.

What expression systems and purification strategies are most effective for producing recombinant P. cryohalolentis ATP synthase subunit b (atpF)?

Successful expression and purification of recombinant P. cryohalolentis ATP synthase subunit b requires careful consideration of several factors based on its psychrophilic origin and membrane protein nature:

Recommended expression systems:

Expression SystemAdvantagesConsiderations
E. coli BL21(DE3)High yield, established protocolsMay require cold-induction strategies
E. coli Arctic ExpressContains cold-adapted chaperonesBetter folding at lower temperatures
E. coli C41/C43Specialized for membrane proteinsReduced toxicity during expression
Cell-free systemsAvoids toxicity issuesAllows addition of lipids/detergents

Optimized purification strategy:

  • Membrane preparation:

    • Harvest cells and disrupt by French press or sonication in buffer containing 50 mM Tris-HCl pH 8.0, 5 mM MgCl₂, 10% glycerol

    • Collect membranes by ultracentrifugation (435,000 × g, 10 min)

  • Solubilization:

    • Solubilize membranes with mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin

    • Maintain low temperature (4°C) throughout purification

  • Affinity chromatography:

    • For His-tagged constructs, use Ni-NTA affinity chromatography

    • Wash extensively to remove non-specifically bound proteins

    • Elute with imidazole gradient

  • Additional purification steps:

    • Size exclusion chromatography to separate oligomeric states

    • Ion exchange chromatography if higher purity is required

  • Storage buffer optimization:

    • Final buffer: Tris-based buffer with 50% glycerol

    • Store at -20°C/-80°C in small aliquots to avoid freeze-thaw cycles

This strategy has been developed based on successful approaches for similar membrane proteins and cold-adapted enzymes from psychrophilic organisms.

How do the structural and functional properties of ATP synthase from P. cryohalolentis compare to mesophilic and thermophilic homologs?

ATP synthase from P. cryohalolentis displays distinct structural and functional adaptations compared to mesophilic and thermophilic homologs, reflecting evolutionary strategies for functioning at low temperatures:

Comparative analysis of ATP synthase properties across temperature adaptations:

PropertyP. cryohalolentis (Psychrophile)Mesophilic HomologsThermophilic Homologs
Optimal catalytic temperature22°C (functions down to -80°C) 37°C55-80°C
Structural flexibilityHigh - enhanced local motilityModerateLow - rigid structure
Amino acid compositionHigher proportion of non-polar residues, fewer proline residuesBalanced compositionRich in charged residues and prolines
ATP/ADP concentration responseIncreases at low temperatures Decreases at low temperaturesStable across optimal range
Proton motive force requirementMaintained even in frozen conditions Required at physiological temperaturesHigh at optimal temperature
Cold inactivationResistant to cold denaturationSusceptibleRapid inactivation at low temperatures
Thermal stabilityLower thermal stabilityModerate stabilityHigh thermal stability

The psychrophilic ATP synthase from P. cryohalolentis shows unique adaptations that allow it to function efficiently at temperatures where mesophilic and thermophilic homologs would be inactive . The atpF (subunit b) plays a critical role in maintaining the structural integrity of the enzyme complex under these extreme conditions.

These differences highlight the principle of protein structural adaptations to environmental conditions, with psychrophilic enzymes generally showing increased catalytic efficiency at low temperatures at the expense of thermal stability.

What site-directed mutagenesis approaches can be used to study structure-function relationships in P. cryohalolentis ATP synthase subunit b?

Site-directed mutagenesis provides powerful tools for examining structure-function relationships in P. cryohalolentis ATP synthase subunit b. Based on sequence analysis and structural predictions, several targeted experimental approaches can be implemented:

Key residues for mutagenesis investigation:

RegionTarget ResiduesRationaleExpected Functional Impact
Membrane anchorM1, N2, L5, I10Hydrophobic residues likely involved in membrane associationAlterations may affect membrane integration and complex stability
Peripheral stalkK39, E43, K47Charged residues potentially forming salt bridgesMutations may destabilize interactions with other subunits
Dimerization interfaceA81, L85, E88Residues likely involved in b-b dimerizationChanges could affect dimer formation and peripheral stalk structure
F₁ interactionL131, E135, K138C-terminal region interacting with F₁ domainMutations may disrupt energy coupling between F₁ and F₀
Cold adaptationG9, A14, L68, L94Residues providing flexibility at low temperaturesSubstitutions with rigid residues may reduce cold activity

Recommended mutagenesis protocols:

  • Gene isolation and cloning:

    • PCR amplification of atpF gene using degenerate forward primer and species-specific reverse primers as described in reference

    • Clone into expression vectors like pMiniT or established E. coli expression vectors

  • Mutagenesis methods:

    • For single mutations: QuikChange site-directed mutagenesis

    • For multiple/scanning mutations: Gibson Assembly or Golden Gate Assembly

    • For domain swapping: Overlap extension PCR with mesophilic ATP synthase domains

  • Functional analysis:

    • ATP synthesis activity assays at different temperatures (22°C to -15°C)

    • Proton translocation measurements using pH-sensitive fluorescent probes

    • Protein-protein interaction studies using cross-linking or pull-down assays

    • Thermal stability measurements using differential scanning calorimetry

  • Validation techniques:

    • Gene knockout and complementation studies in P. cryohalolentis using established protocols similar to those for P. arcticus

    • Growth rate experiments at various temperatures (22°C to -2.5°C)

    • Measurement of in vivo ATP levels using luciferase-based assays

These approaches can reveal how specific residues contribute to the cold adaptation of ATP synthase and provide insights into the molecular basis of psychrophilic enzyme function.

How does the proton motive force in P. cryohalolentis remain functional at sub-zero temperatures, and what role does the ATP synthase structure play?

The maintenance of a functional proton motive force (pmf) at sub-zero temperatures in P. cryohalolentis represents an extraordinary adaptation, with the ATP synthase complex playing a central role:

Mechanisms maintaining pmf at sub-zero temperatures:

  • Membrane adaptations:

    • P. cryohalolentis membranes contain increased proportions of unsaturated fatty acids

    • This maintains membrane fluidity at low temperatures, allowing proton translocation

    • The ATP synthase subunit b (atpF) must anchor effectively in this modified membrane environment

  • Experimental evidence for functional pmf at extreme cold:

    • Studies using respiratory uncouplers demonstrate that the temperature-dependent increase in ATP levels requires intact pmf

    • This indicates that the electron transport chain remains functional even when cells are frozen

    • The proton gradient (p-side positively charged, n-side negatively charged) persists at temperatures as low as -80°C

  • Structural adaptations in ATP synthase for cold-active proton translocation:

    • The a/b subunit interface in F₀ likely contains modified amino acids that maintain appropriate spatial relationships despite reduced thermal motion

    • The conserved arginine in subunit a (a-Arg159 in humans ) and equivalent residue in P. cryohalolentis must maintain interaction with c-ring glutamate despite thermal constraints

    • The peripheral stalk, of which subunit b is a key component, must remain flexible enough to accommodate conformational changes during rotation

  • Kinetic compensation mechanisms:

    • Increased local concentration of ATP and ADP at low temperatures

    • This concentration effect may compensate for reduced kinetic energy

    • Enhanced substrate binding affinity at low temperatures may facilitate reactions despite reduced molecular motion

Understanding how the pmf is maintained at sub-zero temperatures provides crucial insights into microbial survival in permanently frozen environments and the extremes at which chemiosmotic energy conservation can function.

What structural biology techniques are most appropriate for studying the conformation of P. cryohalolentis ATP synthase subunit b, and what technical challenges must be overcome?

Investigating the structure of P. cryohalolentis ATP synthase subunit b presents unique challenges due to its membrane association and psychrophilic origin. Several structural biology techniques offer complementary approaches:

Comparative analysis of structural biology methods for atpF:

TechniqueAdvantagesChallengesOptimization Strategies
Cryo-electron microscopy (cryo-EM)Can visualize entire ATP synthase complex; works well for membrane proteinsRequires high protein concentration; image processing challengesUse higher magnification; specialized detergents; collect data at multiple temperatures
X-ray crystallographyHigh resolution potential; precedent for ATP synthase components Difficult to crystallize membrane proteins; crystal packing forces may distort structureLipidic cubic phase crystallization; antibody fragment co-crystallization; microcrystal approaches
Nuclear Magnetic Resonance (NMR)Can study dynamics; works for smaller domainsSize limitations; membrane protein challengesFocus on soluble domains; detergent micelle optimization; selective isotope labeling
Hydrogen-deuterium exchange MSProvides information on solvent accessibility and dynamicsLimited spatial resolutionOptimize pepsin digestion; compare exchange rates at different temperatures
Molecular dynamics simulationCan model cold-adaptation dynamics; no protein purification neededRequires validation with experimental dataUse enhanced sampling techniques; incorporate experimental constraints
Small-angle X-ray scattering (SAXS)Studies protein in solution; less sample requirementsLower resolution; challenges with detergent subtractionCombine with other structural techniques; size-exclusion chromatography coupled SAXS

Key technical challenges specific to P. cryohalolentis atpF:

  • Temperature considerations during structural studies:

    • Maintaining appropriate temperature during data collection

    • Potential structural changes at different temperatures that may be physiologically relevant

    • Need for specialized cold-temperature sample handling

  • Expression and purification optimization:

    • Expressing properly folded protein in sufficient quantities

    • Maintaining native-like lipid environment

    • Avoiding aggregation during concentration

  • Structural determination within the complex:

    • atpF functions as part of the larger ATP synthase complex

    • Interactions with other subunits may be essential for native conformation

    • May need to develop reconstitution systems with other ATP synthase components

Recent advances in cryo-EM have enabled the determination of complete ATP synthase structures , suggesting this may be the most promising approach for studying the P. cryohalolentis complex, potentially revealing unique adaptations that enable function at extremely low temperatures.

How can recombinant P. cryohalolentis ATP synthase subunit b be utilized in bioenergetic research applications?

Recombinant P. cryohalolentis ATP synthase subunit b offers several valuable applications in bioenergetic research, particularly for studying energy metabolism at low temperatures:

Research applications:

  • Model system for cold-adapted bioenergetics:

    • Investigating energy conservation mechanisms at sub-zero temperatures

    • Comparative studies with mesophilic and thermophilic ATP synthases

    • Exploring fundamental principles of chemiosmotic energy conservation in extreme environments

  • Reconstitution studies:

    • Development of proteoliposomes containing recombinant atpF with other ATP synthase components

    • Measurement of ATP synthesis at different temperatures

    • Investigation of proton translocation efficiency as a function of temperature

  • Biophysical research tools:

    • Using labeled atpF to study membrane protein dynamics at low temperatures

    • Exploring structural transitions during ATP synthesis cycle

    • Investigating protein-protein interactions in the peripheral stalk

  • Biotechnological applications:

    • Development of cold-active ATP regeneration systems for enzymatic reactions

    • Creation of biosensors functional at low temperatures

    • Engineering energy-efficient systems based on psychrophilic principles

Experimental designs for bioenergetic studies:

Research QuestionExperimental ApproachExpected Outcomes
Role of atpF in cold adaptation of ATP synthaseChimeric constructs with mesophilic atpF domainsIdentification of regions critical for cold activity
Interaction partners of atpF in the ATP synthase complexCross-linking studies at different temperaturesTemperature-dependent changes in interaction network
atpF contribution to ATP synthase assemblyIn vitro reconstitution with purified componentsDetermination of assembly pathway and critical interactions
Energy coupling efficiency at different temperaturesATP synthesis measurements in proteoliposomesQuantification of temperature-activity relationship

These research applications leverage the unique properties of P. cryohalolentis atpF to address fundamental questions in bioenergetics and potentially develop novel biotechnological applications.

What are the similarities and differences between ATP synthase subunits from P. cryohalolentis and other psychrophilic bacteria?

Comparative analysis of ATP synthase subunits across psychrophilic bacteria reveals both conserved features related to cold adaptation and species-specific differences that may reflect ecological niches:

Comparative analysis of ATP synthase subunits:

FeatureP. cryohalolentisP. arcticusOther PsychrophilesSignificance
Optimal growth temperature22°C (growth to -10°C) 22°C (transcriptome changes <4°C) Typically 15-20°CP. cryohalolentis and P. arcticus share similar temperature optima despite different habitats
ATP synthase gene regulationMaintains expression at low tempsDownregulates at low temps VariableDifferent energy conservation strategies at low temperatures
Gene organizationatpF (Pcryo_2331) near atpB (Pcryo_2333) Similar operon structureGenerally conservedConservation of ATP synthase gene cluster across species
Cold adaptation mechanismATP/ADP concentration increase Resource efficiency response Various strategiesDifferent approaches to maintaining energy metabolism in cold
Protein sequencesContains cold-adapted featuresSimilar adaptationsVarious modificationsConvergent evolution of cold-active features

Structural adaptations across psychrophilic ATP synthases:

  • Common adaptations:

    • Reduced proline content in flexible regions

    • Decreased hydrophobic core packing

    • Increased surface hydrophilicity

    • Modified ion-pair networks

  • P. cryohalolentis-specific features:

    • Unique amino acid composition in atpF (156 amino acids)

    • Specialized membrane anchor region adapted to P. cryohalolentis lipid composition

    • Specific peripheral stalk interactions

  • Functional implications:

    • P. cryohalolentis employs an adenylate concentration strategy at low temperatures

    • P. arcticus employs resource efficiency and molecular adaptations

    • These represent different evolutionary solutions to the challenge of cold environments

This comparative analysis highlights the diversity of adaptations even among related psychrophilic bacteria, suggesting that cold adaptation of energy metabolism has evolved multiple times with different molecular strategies.

What role does ATP synthase play in the remarkable ability of P. cryohalolentis to maintain metabolic activity in frozen environments?

The extraordinary capacity of P. cryohalolentis to maintain metabolic activity at sub-zero temperatures is intricately linked to adaptations in its ATP synthase complex, particularly involving the F₀ sector where subunit b (atpF) plays a crucial structural role:

ATP synthase contributions to frozen-state metabolism:

  • Enhanced adenylate production:

    • Cellular ATP and ADP concentrations increase significantly with decreasing temperature

    • The most dramatic increases occur in frozen suspensions below -5°C

    • This response requires a functional proton motive force, indicating active ATP synthesis

  • Kinetic compensation mechanism:

    • Higher substrate concentrations help offset decreased molecular motion

    • ATP and ADP are key substrates in numerous metabolic reactions

    • Increased adenylate levels develop within 1 hour after freezing

  • ATP synthase structural adaptations:

    • The peripheral stalk (including atpF) maintains appropriate spacing between F₁ and F₀ domains despite reduced molecular mobility

    • The c-ring/subunit a interface maintains proton translocation capability

    • The entire complex remains functional at temperatures as low as -80°C

  • Integration with cellular adaptation:

    • ATP maintenance supports cellular survival during freezing

    • Similar to how an E. coli mutant with elevated ATP was more tolerant to cold storage

    • May support repair processes and membrane integrity maintenance

These adaptations collectively represent a sophisticated strategy for maintaining energy metabolism under extreme conditions, with ATP synthase serving as a central component. The ability to generate ATP at temperatures as low as -80°C demonstrates that chemiosmotic energy conservation can function far beyond previously assumed temperature limits.

This physiological response likely represents a critical biochemical compensation mechanism for survival during freezing and persistence in permanently frozen environments like Siberian permafrost .

What analytical techniques are most effective for measuring ATP synthase activity in P. cryohalolentis at sub-zero temperatures?

Measuring ATP synthase activity at sub-zero temperatures presents unique technical challenges that require specialized approaches:

Recommended analytical techniques for sub-zero ATP synthase activity:

TechniquePrincipleAdvantagesChallengesTemperature Range
Luciferase-based ATP assayATP-dependent light emissionHigh sensitivity; established protocolsMay have reduced activity at low temperaturesDown to -80°C with modifications
Radiolabeled substrate incorporationTracking ^32P incorporation from P_i to ATPDirect measure of synthesis; high sensitivityHandling radioactive materials; specialized equipment-15°C to -80°C
Enzyme-coupled spectrophotometric assaysLink ATP production to NAD(P)H oxidationContinuous monitoring; commercially availableCoupling enzymes may be temperature-sensitiveAbove -10°C typically
High-performance liquid chromatography (HPLC)Direct quantification of nucleotidesMeasures multiple nucleotides simultaneously; high accuracySample preparation challenges; specialized equipmentAny temperature with appropriate sample handling
Oxygen consumption measurementsMeasures respiratory activity linked to ATP synthesisProvides real-time activity dataRequires specialized equipment for low temperaturesDown to freezing point of media
Proton translocation assayspH-sensitive fluorescent dyesDirectly measures proton movementSignal-to-noise challenges at low temperaturesLimited by probe characteristics

Methodological considerations for sub-zero measurements:

  • Antifreeze components:

    • Addition of glycerol or ethylene glycol to prevent complete freezing

    • Must validate that these components don't interfere with enzymatic activity

    • Concentration needs optimization to allow measurements at desired temperatures

  • Specialized instrumentation:

    • Temperature-controlled chambers capable of stable sub-zero temperatures

    • Modified sample holders for frozen or semi-frozen samples

    • Calibration standards that function at low temperatures

  • Sample preparation:

    • Rapid sampling techniques to preserve in vivo state

    • Extraction protocols optimized for frozen samples

    • Consideration of ice formation effects on local concentrations

  • Controls and validation:

    • Include respiratory uncouplers as negative controls

    • Validate measurements with multiple independent techniques

    • Include temperature transition controls to account for adaptation periods

These analytical approaches have revealed that P. cryohalolentis maintains ATP synthesis at temperatures as low as -80°C , providing insights into the extreme limits of bioenergetic processes.

What emerging techniques might advance our understanding of ATP synthase function in extremophiles like P. cryohalolentis?

Several cutting-edge technologies show promise for revealing new insights into extremophile ATP synthase function:

Emerging techniques with potential applications:

  • Cryo-electron tomography:

    • Allows visualization of ATP synthase in near-native cellular context

    • Could reveal organization and distribution in P. cryohalolentis membranes

    • May identify unique structural features only present in the cellular environment

  • Single-molecule biophysics:

    • FRET-based approaches to study conformational changes at low temperatures

    • Optical/magnetic tweezers to measure torque generation by psychrophilic ATP synthases

    • Single-molecule electrophysiology to study proton translocation

  • In-cell structural biology:

    • NMR studies in intact cells to evaluate native protein dynamics

    • Mass spectrometry of intact complexes to determine subunit stoichiometry

    • Cross-linking mass spectrometry to map interaction networks

  • Synthetic biology approaches:

    • Minimal ATP synthase constructs to identify essential cold-adaptation features

    • Designer ATP synthases incorporating psychrophilic modules into mesophilic scaffolds

    • Directed evolution to enhance cold activity or understand adaptation pathways

  • Advanced computational methods:

    • Molecular dynamics simulations incorporating quantum effects relevant at low temperatures

    • Machine learning approaches to identify patterns in cold-adapted proteins

    • Systems biology modeling of ATP homeostasis at different temperatures

Research questions addressable with these techniques:

Research QuestionTechniqueExpected Impact
How does the rotation mechanism of ATP synthase function at sub-zero temperatures?Single-molecule rotation assays at controlled temperaturesUnderstanding of mechanical adaptations to cold
What is the native organization of ATP synthase in P. cryohalolentis membranes?Cryo-electron tomographyInsights into membrane organization and potential supercomplexes
Which residues in atpF are critical for cold adaptation?Deep mutational scanning combined with functional assaysComprehensive map of sequence-function relationships
How do protein dynamics change across the temperature range from 22°C to -80°C?Temperature-dependent HDX-MS or NMRUnderstanding of dynamic adaptations to cold
Can psychrophilic ATP synthase components function in mesophilic hosts?Synthetic biology with chimeric ATP synthasesPrinciples for engineering cold-active energy systems

These emerging approaches promise to provide deeper insights into the molecular basis of ATP synthase function at extreme temperatures, with potential applications in biotechnology and understanding the limits of life.

What can we learn from studying P. cryohalolentis ATP synthase that might be applicable to human mitochondrial ATP synthase disorders?

Research on P. cryohalolentis ATP synthase offers unexpected insights relevant to human mitochondrial ATP synthase disorders, despite the evolutionary distance between these systems:

Translational insights for human ATP synthase disorders:

  • Structure-function relationships:

    • While ATP synthase architecture is conserved across species, the detailed mechanisms of psychrophilic adaptations may reveal fundamental principles about ATP synthase operation

    • Understanding how P. cryohalolentis ATP synthase maintains function under extreme conditions may provide insights into resilience factors that could be therapeutic targets

  • Energetic compensation mechanisms:

    • P. cryohalolentis increases adenylate concentrations to maintain function at low temperatures

    • Similar compensation mechanisms might be explored as therapeutic strategies for mitochondrial disorders where ATP synthase activity is compromised

    • This presents an alternative to current approaches focused on the enzyme itself

  • Perspectives on pathogenic mutations:

    • Of the 58 different mutations in mitochondrial genes encoding ATP synthase subunits 8 and a associated with human disorders , some affect conserved residues

    • Comparative studies with bacterial homologs can help classify variants and understand functional impacts

    • The bacterial system offers a simpler model for mechanistic studies

  • Potential therapeutic applications:

    • Understanding temperature-dependent conformational changes might inform drug design

    • Compounds that modify ATP synthase stability or assembly identified in bacterial systems could have therapeutic potential

    • Psychrophilic ATP synthases could serve as alternative enzyme sources for replacement therapies

Comparative analysis of ATP synthase disorders and cold adaptations:

Human ATP Synthase Disorder FeatureRelevant P. cryohalolentis AdaptationPotential Research Application
Reduced catalytic efficiencyEnhanced catalytic activity at low temperaturesInsights into compensatory mechanisms
Assembly defectsStable complex formation under extreme conditionsUnderstanding principles of complex stability
Proton leak disordersMaintained proton gradient integrity at low temperaturesApproaches to minimize proton leakage
Reduced ATP productionIncreased adenylate concentration strategiesMetabolic compensation approaches
Oxidative stress vulnerabilityAdaptive responses to environmental stressProtective mechanisms against damage

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.