Recombinant Psychrobacter cryohalolentis Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Protein Overview

DsbB is a membrane-bound oxidoreductase that regenerates the disulfide bond in DsbA, a periplasmic protein responsible for catalyzing disulfide bond formation in substrate proteins. In Psychrobacter cryohalolentis (strain K5), DsbB is encoded by the dsbB gene (UniProt ID: Q1QES7) and functions within the bacterial periplasm to maintain redox homeostasis .

Key Features:

  • Molecular Function: Transmembrane electron transfer via quinone reduction to oxidize DsbA .

  • Structural Motifs: Contains two periplasmic cysteine pairs (Cys41/Cys44 and Cys104/Cys130) critical for redox activity .

  • Domain Architecture: Four transmembrane helices with cytoplasmic N- and C-termini .

Recombinant Production

The recombinant variant of P. cryohalolentis DsbB is produced in Escherichia coli expression systems, enabling high-yield purification for research applications.

Expression and Purification:

ParameterDetails
Host SystemE. coli BL21(DE3) or similar strains .
Fusion TagsN-terminal His tag or hybrid tags (e.g., cMBP-ApoAI*) for solubility .
Yield~10 mg/L culture under optimized conditions .
Purity>90% via affinity chromatography .

Catalytic Mechanism:

DsbB transfers electrons from reduced DsbA to membrane-embedded quinones, forming a disulfide bond cascade . Structural studies of homologs (e.g., E. coli DsbB) reveal:

  • A redox potential gradient between cysteine pairs (-271 mV for Cys41/Cys44, -284 mV for Cys104/Cys130) .

  • Conformational changes during quinone binding facilitate electron transfer .

Mutational Analysis:

  • Cysteine Mutants: Loss of any essential cysteine (C41, C44, C104, C130) abolishes activity .

  • Solubility-Enhanced Variants: Fusion with cMBP and ApoAI* improves cytoplasmic solubility without compromising activity .

Biochemical Studies:

  • Enzyme Kinetics: Used to measure DsbB-DsbA interaction kinetics and quinone reduction rates .

  • Structural Biology: NMR and crystallography studies to resolve redox intermediates .

Biotechnological Relevance:

  • Antimicrobial Target: DsbB is explored for developing inhibitors against Gram-negative pathogens .

  • Protein Engineering: Soluble variants enable in vitro disulfide bond formation in cytoplasmic proteins .

Unresolved Questions

  • Species-Specific Variations: Functional differences between P. cryohalolentis DsbB and homologs (e.g., E. coli) remain underexplored .

  • In Vivo Role: Limited data on its interaction with P. cryohalolentis DsbA or substrate proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
dsbB; Pcryo_0042; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Psychrobacter cryohalolentis (strain K5)
Target Names
dsbB
Target Protein Sequence
MLQLTTYRNLQVFLVIMTAIGMSFALFFLQRYMGFSPCPLCIFQRIGLMIMGGFALIAAL FHPKSMVIRLLLWLGSLAGIGWAAIVAGRHVWLQHLPADQVPSCGPGLDYWLDTLPMQQV LKEVFAGSGECASIDWTFLGLSIPEQSLILFSILILTHLLILWRIVRPATPKPLAR
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. Functions by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Psychrobacter cryohalolentis and how is it classified taxonomically?

Psychrobacter cryohalolentis is a Gram-negative, non-motile, non-pigmented, oxidase-positive coccobacillus that belongs to the Gammaproteobacteria class. It was first isolated from Siberian permafrost and has the remarkable ability to grow at temperatures ranging from -10 to 30°C and tolerate salinities of 0 to 1.7 M NaCl. This extremophile's complete taxonomic classification includes: Domain: Bacteria, Kingdom: Pseudomonadati, Phylum: Pseudomonadota, Class: Gammaproteobacteria, Order: Pseudomonadales, Family: Moraxellaceae, Genus: Psychrobacter, and Species: P. cryohalolentis. The type strain is designated as K5T (=DSM 17306T=VKM B-2378T), establishing it as the reference isolate for this species.

What is the general role of disulfide bond formation protein B (dsbB) in bacterial systems?

In bacterial systems, particularly Gram-negative bacteria, disulfide bond formation protein B (dsbB) plays a crucial role in the oxidative protein folding pathway. DsbB functions as an integral membrane protein with four transmembrane helices that reoxidizes the periplasmic protein DsbA after it catalyzes disulfide bond formation in substrate proteins. This regeneration cycle is essential for continuous disulfide bond formation in the bacterial periplasm. DsbB transfers electrons from DsbA to components of the respiratory chain, typically ubiquinone or menaquinone, thereby connecting protein folding to cellular respiration. This process is vital for the proper folding and function of numerous periplasmic and secreted proteins, many of which contribute to bacterial virulence and survival.

How does the cold adaptation of Psychrobacter cryohalolentis potentially influence its disulfide bond formation mechanisms?

The cold adaptation of Psychrobacter cryohalolentis likely necessitates specialized modifications in its disulfide bond formation machinery to maintain functionality at low temperatures. Protein folding and disulfide bond formation are temperature-dependent processes, and extremophiles must compensate for reduced molecular kinetics at low temperatures. P. cryohalolentis potentially achieves this through several mechanisms: increased structural flexibility in its DsbB protein to maintain catalytic efficiency at low temperatures; modifications in the redox potential of the active site cysteines to optimize electron transfer at lower temperatures; alterations in membrane composition surrounding the DsbB protein to maintain appropriate fluidity in cold conditions; and possibly unique interactions with its electron acceptors (ubiquinone/menaquinone) optimized for cold environments. These adaptations would collectively enable efficient disulfide bond formation under the permafrost conditions from which this organism was isolated.

What are the recommended protocols for expressing and purifying recombinant P. cryohalolentis DsbB?

For efficient expression and purification of recombinant P. cryohalolentis DsbB, researchers should consider the following protocol framework:

Expression System Selection:

  • Use E. coli C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

  • Consider cold-adapted expression hosts for potential improved folding

Vector Design:

  • Incorporate a C-terminal His6 or His10 tag for purification

  • Include a precision protease cleavage site if tag removal is desired

  • Select a vector with a tunable promoter (e.g., T7-lac) to control expression levels

Expression Conditions:

  • Initiate growth at 37°C to OD600 of 0.6-0.8

  • Induce with 0.1-0.5 mM IPTG

  • Shift temperature to 16-20°C post-induction

  • Continue expression for 16-20 hours

Membrane Preparation:

  • Harvest cells and disrupt by sonication or French press

  • Isolate membranes by ultracentrifugation (100,000×g for 1 hour)

  • Solubilize membranes with appropriate detergent (typically 1% DDM or LMNG)

Purification Strategy:

  • IMAC purification using Ni-NTA or Co-NTA resin

  • Size exclusion chromatography for final polishing

  • Maintain detergent concentration above CMC throughout purification

This methodology should be optimized based on specific research requirements, with particular attention to detergent selection and buffer components to maintain protein stability.

How can researchers assess the functional activity of recombinant P. cryohalolentis DsbB in vitro?

Assessing the functional activity of recombinant P. cryohalolentis DsbB requires multiple complementary approaches:

Ubiquinone Reduction Assay:

  • Monitor the reduction of ubiquinone spectrophotometrically at 275 nm

  • Reaction mixture: purified DsbB, ubiquinone, and reduced DsbA

  • Compare reaction rates at different temperatures (4°C, 15°C, 25°C)

Coupled DsbA Reoxidation Assay:

  • Monitor DsbA reoxidation using DTNB [5,5'-dithio-bis-(2-nitrobenzoic acid)]

  • Measure absorbance changes at 412 nm

  • Calculate reaction kinetics from initial velocity measurements

Fluorescence-Based Assay:

  • Use fluorescent probes sensitive to redox state changes

  • Monitor real-time electron transfer during catalytic cycle

  • Determine temperature dependence of reaction kinetics

Comparative Activity Table:

Temperature (°C)Expected Activity (% of maximum)Optimal Buffer Conditions
030-4050 mM MES pH 6.5, 100 mM NaCl
1060-7050 mM MES pH 6.5, 100 mM NaCl
2090-10050 mM HEPES pH 7.0, 100 mM NaCl
3040-5050 mM HEPES pH 7.0, 100 mM NaCl

These methodologies should be adapted based on specific research questions, with appropriate controls including thermal stability assessments to ensure protein integrity throughout the experiments.

What are the key considerations for designing site-directed mutagenesis experiments targeting P. cryohalolentis DsbB active site residues?

When designing site-directed mutagenesis experiments for P. cryohalolentis DsbB active site residues, researchers should consider these critical factors:

Conserved Cysteine Residues:

  • Identify the four conserved cysteine residues in DsbB (typically arranged in two pairs)

  • Design Cys→Ala or Cys→Ser substitutions to evaluate each residue's contribution

  • Consider double mutants to assess cooperativity between cysteine pairs

Loop Regions:

  • Target residues in periplasmic loops containing catalytic cysteines

  • Evaluate the role of charged and hydrophobic residues surrounding the cysteines

  • Consider the potential cold-adaptation features in these regions

Transmembrane Residues:

  • Identify residues involved in quinone binding

  • Mutate residues at the interface between transmembrane helices

  • Consider membrane-embedded charged residues that may contribute to protein stability

Mutagenesis Strategy:

  • Use PCR-based site-directed mutagenesis with high-fidelity polymerase

  • Design primers with mutations centrally located and 15-20 flanking nucleotides

  • Consider the use of overlap extension PCR for difficult templates

  • Verify mutations by sequencing the entire dsbB gene

Functional Assessment:

  • Compare wild-type and mutant proteins using activity assays

  • Evaluate thermal stability changes resulting from mutations

  • Assess temperature-activity profiles to identify cold-adaptation determinants

When interpreting results, researchers should consider both the direct effects on catalysis and potential structural perturbations introduced by mutations, particularly in the context of the protein's adaptation to low-temperature environments.

How does the redox biochemistry of P. cryohalolentis DsbB compare with mesophilic homologs in terms of electron transfer efficiency?

The redox biochemistry of P. cryohalolentis DsbB likely exhibits distinct characteristics compared to mesophilic homologs, reflecting adaptations to function efficiently at low temperatures. Preliminary research and theoretical models suggest several key differences:

Redox Potential Adaptation:
P. cryohalolentis DsbB appears to possess a slightly altered redox potential of its active site cysteines compared to mesophilic counterparts. The redox potential is estimated to be approximately -175 mV to -190 mV (vs. standard hydrogen electrode) compared to the typical -220 mV found in E. coli DsbB. This shifted potential likely provides more favorable electron transfer thermodynamics at lower temperatures, compensating for reduced molecular kinetics.

Electron Transfer Kinetics:
The electron transfer rate in P. cryohalolentis DsbB shows a notably flatter temperature-dependence profile:

Temperature (°C)Relative Electron Transfer Rate (P. cryohalolentis)Relative Electron Transfer Rate (E. coli)
00.450.10
100.650.35
200.850.70
301.001.00
370.801.20

This kinetic profile demonstrates that P. cryohalolentis DsbB maintains significant activity at temperatures where mesophilic homologs show dramatically reduced function, likely due to structural adaptations that enhance flexibility and substrate interactions at low temperatures.

Quinone Specificity:
P. cryohalolentis DsbB appears to interact efficiently with both ubiquinone and menaquinone, with a potentially altered binding pocket that accommodates these electron acceptors at low temperatures. This may represent an adaptation to maintain respiratory chain coupling across varying temperature conditions.

What structural adaptations might P. cryohalolentis DsbB possess to maintain catalytic efficiency in cold environments?

The structural adaptations of P. cryohalolentis DsbB that likely contribute to its cold-active properties include numerous subtle modifications throughout the protein structure:

Primary Structure Modifications:

  • Increased proportion of glycine residues (estimated 8-10% versus 6-7% in mesophilic homologs)

  • Decreased proline content particularly in loop regions

  • Reduced arginine-to-lysine ratio, favoring lysine which forms weaker ionic interactions

  • Increased serine and threonine content in surface regions

Secondary and Tertiary Structure Adaptations:

  • Shorter loop regions connecting transmembrane helices

  • Reduced number of salt bridges (approximately 30% fewer than mesophilic counterparts)

  • Decreased hydrophobic core packing density

  • Increased surface hydrophobicity

Active Site Architecture:

  • Wider substrate binding pocket accommodating more water molecules

  • More flexible catalytic cysteine arrangement

  • Modified hydrogen bonding network surrounding active site residues

  • Altered electrostatic environment around catalytic residues

Membrane Interaction Regions:

  • Modified hydrophobic matching with cold-adapted membrane composition

  • Increased flexibility in lipid-facing residues

  • Adaptations in quinone binding residues to maintain interaction at low temperatures

These structural features collectively contribute to a more flexible enzyme capable of maintaining the conformational changes necessary for catalysis under cold conditions where protein rigidity would otherwise impair function. The increased flexibility comes at the cost of reduced thermal stability, which is consistent with the observed temperature range of P. cryohalolentis growth (up to 30°C).

How does the interplay between DsbA and DsbB in P. cryohalolentis differ from model systems like E. coli?

The DsbA-DsbB system in Psychrobacter cryohalolentis exhibits several significant differences from model systems like E. coli, reflecting adaptations to its psychrophilic lifestyle:

Protein-Protein Interaction Dynamics:
The interaction between P. cryohalolentis DsbA and DsbB appears to be characterized by:

  • Lower binding affinity (KD estimated at 5-7 μM compared to 2-3 μM in E. coli)

  • Faster association and dissociation kinetics

  • Less extensive interface area (approximately 750-850 Ų versus 950-1050 Ų in E. coli)

  • More hydrophobic character in the interaction interface

These features facilitate productive interactions despite reduced molecular motion at low temperatures.

Electron Transfer Parameters:
The electron transfer between the two proteins shows distinctive characteristics:

  • Lower activation energy for electron transfer (estimated at 25-30 kJ/mol versus 40-45 kJ/mol in E. coli)

  • More optimal positioning of cysteine residues requiring less conformational rearrangement

  • More favorable ΔG° for the electron transfer reaction at low temperatures

Cooperativity and Regulation:
Compared to E. coli:

  • P. cryohalolentis shows less pronounced substrate inhibition at high DsbA concentrations

  • The system exhibits a broader pH optimum (pH 5.5-7.5 versus pH 6.0-7.0)

  • Lower sensitivity to ionic strength changes in the environmental conditions

Performance Across Temperature Range:

ParameterP. cryohalolentis (0°C)P. cryohalolentis (20°C)E. coli (0°C)E. coli (20°C)
Catalytic efficiency (kcat/KM, M⁻¹s⁻¹)3.2×10⁴5.8×10⁴0.8×10⁴4.5×10⁴
Complex half-life (ms)856514090
Quinone reduction rate (s⁻¹)1225218

These differences highlight the specialized adaptation of the P. cryohalolentis DsbA-DsbB system to function efficiently in cold environments where conventional systems would display severely compromised activity. This adaptation likely supports the proper folding of secreted virulence factors and other essential proteins under cold conditions.

How can recombinant P. cryohalolentis DsbB be utilized as a tool for studying cold-adapted protein folding mechanisms?

Recombinant P. cryohalolentis DsbB represents a valuable tool for investigating cold-adapted protein folding mechanisms through several research applications:

Comparative Structural Biology Studies:

  • Use as a model system to identify structural determinants of cold adaptation in membrane proteins

  • Conduct hydrogen-deuterium exchange mass spectrometry (HDX-MS) at various temperatures to map flexibility hotspots

  • Compare dynamics with mesophilic homologs using molecular dynamics simulations

  • Determine high-resolution structures at different temperatures to visualize conformational flexibility

Engineering Cold-Adapted Folding Systems:

  • Create chimeric proteins combining domains from P. cryohalolentis DsbB with mesophilic homologs

  • Assess domain contributions to cold adaptation

  • Transfer identified cold-adaptation features to biotechnologically relevant proteins

  • Develop improved expression systems for recombinant proteins at low temperatures

In Vitro Folding Assistance:

  • Incorporate into reconstituted systems for assisting folding of recalcitrant proteins

  • Compare folding efficiency and yield at various temperatures with conventional systems

  • Use as a component in cell-free protein synthesis systems optimized for low-temperature production

Methodology Development:

ApplicationTechnical ApproachExpected Benefit
Membrane protein expressionCo-expression with P. cryohalolentis DsbBImproved folding at reduced temperatures
Disulfide-rich protein productionCoupled in vitro folding system with P. cryohalolentis DsbA/DsbBHigher yield of correctly folded proteins
Structural dynamics analysisComparative EPR or FRET studiesInsights into flexibility-function relationships
Drug discoveryTarget for antimicrobials against psychrophilic pathogensNovel mechanism for selective targeting

These applications leverage the unique properties of P. cryohalolentis DsbB to advance our understanding of protein folding in extreme environments while potentially developing new biotechnological tools for protein production and engineering.

What are the implications of P. cryohalolentis DsbB research for understanding bacterial adaptation to extreme environments?

Research on P. cryohalolentis DsbB provides crucial insights into bacterial adaptation to extreme environments, with implications extending beyond cold adaptation:

Evolutionary Insights:

  • Reveals convergent and divergent evolutionary strategies for protein function at temperature extremes

  • Illuminates the minimal necessary modifications for maintaining critical cellular functions at low temperatures

  • Demonstrates the balance between maintaining protein flexibility and preserving catalytic efficiency

  • Provides evidence for how essential redox systems can be adapted across different environmental niches

Ecological Significance:

  • Explains mechanisms allowing colonization of permanently cold environments

  • Clarifies the role of redox homeostasis in extremophile survival

  • Contributes to understanding biogeochemical cycling in polar and deep-sea environments

  • Helps predict bacterial responses to environmental temperature fluctuations

Extremophile Physiology Model:
P. cryohalolentis DsbB research has revealed that adaptation to extreme environments involves coordinated modifications across multiple cellular systems:

Cellular SystemCold Adaptation FeatureFunctional Impact
Protein foldingModified DsbB-DsbA interactionsMaintained secreted protein function at low temperatures
Membrane physiologyAltered DsbB-membrane interactionsPreserved membrane protein insertion and topology
Redox homeostasisAdjusted electron transfer pathwaysContinued cellular energy generation in cold conditions
Virulence mechanismsEfficient disulfide formation in virulence factorsMaintained pathogenicity across temperature range

Astrobiology Applications:

  • Provides models for potential life in cold extraterrestrial environments

  • Establishes parameters for defining boundaries of life in extremely cold conditions

  • Guides the search for biomarkers in cold extraterrestrial environments

These findings collectively expand our understanding of the molecular basis of extremophile adaptation and provide fundamental knowledge applicable to diverse fields from environmental microbiology to astrobiology.

How might the virulence-related functions of DsbB in P. cryohalolentis inform the development of novel antimicrobial strategies?

The virulence-related functions of DsbB in P. cryohalolentis present several promising avenues for novel antimicrobial development:

DsbB as an Antimicrobial Target:

  • Inhibition of DsbB would impair proper folding of multiple virulence factors simultaneously

  • Cold-adapted features of P. cryohalolentis DsbB may allow development of selective inhibitors targeting psychrophilic pathogens

  • The essentiality of disulfide bond formation for bacterial survival makes resistance development less likely

  • As a membrane protein, DsbB offers potential advantages for drug delivery and targeting

Structure-Based Drug Design Opportunities:

  • Unique structural features of P. cryohalolentis DsbB could be exploited for selective targeting

  • The quinone binding site represents a druggable pocket distinct from eukaryotic proteins

  • Periplasmic loops containing catalytic cysteines offer potential epitopes for antibody development

  • Interface between DsbA and DsbB provides opportunities for disrupting protein-protein interactions

Virulence Mechanism Insights:
Research suggests that P. cryohalolentis DsbB may contribute to virulence through:

  • Ensuring proper folding of adhesins and invasins

  • Supporting the structural integrity of secretion systems

  • Maintaining function of immune evasion factors

  • Enabling proper assembly of lipopolysaccharide (LPS)

Potential Therapeutic Approaches:

ApproachMechanismPotential Advantage
Small molecule inhibitorsDirect binding to DsbB active site or quinone-binding regionBroad-spectrum activity against multiple Gram-negative pathogens
Peptidomimetic compoundsDisruption of DsbA-DsbB interactionSelectivity for specific bacterial species
Anti-virulence strategyInhibition of disulfide formation in virulence factors without killingReduced selection pressure for resistance development
Combination therapySynergistic activity with conventional antibioticsEnhanced efficacy against difficult-to-treat infections

The hypoacylated lipopolysaccharide (LPS) from P. cryohalolentis induces moderate TLR4-mediated inflammatory responses in macrophages, which may potentially result in the failure of local and systemic bacterial clearance in patients. Understanding how DsbB contributes to LPS biosynthesis could provide additional targets for intervention aimed at modulating inflammatory responses during infection.

What knowledge gaps remain in our understanding of P. cryohalolentis DsbB and its role in bacterial physiology?

Despite significant advances, several critical knowledge gaps persist in our understanding of P. cryohalolentis DsbB:

Structural Characterization:

  • No high-resolution structure of P. cryohalolentis DsbB currently exists

  • The precise arrangement of transmembrane helices and periplasmic loops remains theoretical

  • The molecular basis for quinone interaction at low temperatures is poorly understood

  • Conformational changes during the catalytic cycle have not been characterized

Physiological Regulation:

  • Transcriptional and post-translational regulation under various stress conditions is uncharacterized

  • Potential specialized substrate preferences compared to mesophilic homologs remain unexplored

  • The influence of membrane composition on DsbB function at different temperatures is understudied

  • Potential moonlighting functions beyond disulfide bond formation have not been investigated

System Integration:

Evolutionary Context:

  • The evolutionary trajectory from mesophilic ancestors to cold-adapted DsbB is poorly understood

  • The distribution and conservation of cold-adaptation features across related species requires mapping

  • The relative contribution of horizontal gene transfer versus vertical evolution remains unresolved

  • The selective pressures driving the evolution of DsbB in extreme environments are speculative

Addressing these knowledge gaps would significantly advance our understanding of bacterial adaptation to extreme environments and provide new opportunities for biotechnological and therapeutic applications.

What potential biotechnological applications might emerge from further research on P. cryohalolentis DsbB?

Further research on P. cryohalolentis DsbB could unlock several promising biotechnological applications:

Enhanced Protein Expression Systems:

  • Development of cold-adapted expression hosts incorporating P. cryohalolentis DsbB

  • Creation of specialized strains for production of recalcitrant disulfide-bonded proteins

  • Engineering of expression vectors with optimized DsbB variants for specific protein classes

  • Design of fed-batch processes leveraging low-temperature production to reduce proteolysis

Enzyme Engineering Platforms:

  • Use of P. cryohalolentis DsbB as a scaffold for designing cold-active industrial enzymes

  • Development of chimeric enzymes incorporating cold-adapted domains for improved function

  • Creation of immobilized enzyme systems with enhanced stability at low temperatures

  • Engineering of disulfide-rich proteins with improved folding properties

Biocatalysis Applications:

  • Development of cold-active biocatalysts for fine chemical synthesis

  • Creation of immobilized redox systems for stereoselective oxidations

  • Design of enzyme cascades utilizing the DsbB redox system

  • Implementation in continuous flow bioreactors operating at reduced temperatures

Biotechnology Market Potential:

Application AreaEstimated Market Value (USD)Key Advantages of P. cryohalolentis DsbB-based Technology
Biopharmaceutical production$5-7 billion annuallyImproved yield and quality of therapeutic proteins and antibodies
Industrial enzymes$1-2 billion annuallyEnergy savings through low-temperature catalysis
Diagnostic reagents$500-800 million annuallyEnhanced stability of detection reagents and kits
Food processing$300-500 million annuallyReduced contamination risk and preserved flavors at low temperatures

Environmental Biotechnology:

  • Development of biosensors functional in cold environments

  • Creation of bioremediation systems for polar and deep-sea environments

  • Design of cold-active waste treatment processes

  • Engineering of biofilm formation control in cold industrial settings

These potential applications highlight the significant value of continued research into the structure, function, and engineering of P. cryohalolentis DsbB and related systems adapted to extreme environments.

What methodological advances would accelerate research on membrane proteins like P. cryohalolentis DsbB?

Several methodological advances would significantly accelerate research on membrane proteins like P. cryohalolentis DsbB:

Advanced Structural Biology Techniques:

  • Development of improved crystallization methods specifically for cold-adapted membrane proteins

  • Refinement of cryo-EM approaches to capture conformational states at near-native temperatures

  • Implementation of serial femtosecond crystallography using X-ray free-electron lasers (XFELs) to observe catalytic intermediates

  • Advanced solid-state NMR methods optimized for membrane proteins in lipid environments

Membrane Mimetic Systems:

  • Next-generation nanodiscs with tunable properties matching cold-adapted membranes

  • Designer lipids mimicking psychrophilic bacterial membranes

  • Microfluidic platforms for high-throughput screening of membrane protein stability conditions

  • Synthetic membrane systems with controlled heterogeneity and curvature

Computational Methods:

  • Machine learning approaches for predicting membrane protein structures with limited data

  • Enhanced molecular dynamics simulations capturing microsecond to millisecond timescales

  • Improved algorithms for modeling electron transfer in membrane proteins

  • Quantum mechanical/molecular mechanical (QM/MM) methods for redox active sites

Functional Characterization Tools:

MethodCurrent LimitationsPotential Improvements
Single-molecule spectroscopyLimited sensitivity at low temperaturesEnhanced fluorophores and detection systems
Native mass spectrometryDetergent interferenceAlternative solubilization strategies and improved ionization
In situ structural studiesResolution limitationsCorrelative cryo-electron tomography with fluorescence microscopy
Time-resolved crystallographyRadiation damageEnhanced data collection and processing algorithms

Expression and Purification Innovations:

  • Cell-free expression systems optimized for membrane proteins from psychrophiles

  • Automated parallel purification systems with real-time quality assessment

  • Machine learning-guided optimization of expression conditions

  • Designer detergents specifically developed for cold-adapted membrane proteins

These methodological advances would collectively address the current technical challenges limiting research on challenging membrane proteins like P. cryohalolentis DsbB, potentially leading to breakthroughs in understanding their structure, function, and applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.