Recombinant Psychrobacter cryohalolentis Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Psychrobacter cryohalolentis Large-Conductance Mechanosensitive Channel (MscL)

The Recombinant Psychrobacter cryohalolentis Large-Conductance Mechanosensitive Channel (MscL) is a recombinant protein derived from the psychrophilic bacterium Psychrobacter cryohalolentis. This channel belongs to the MscL family of mechanosensitive ion channels, which play critical roles in osmotic regulation by releasing cytoplasmic solutes under hypoosmotic stress. Below is a detailed analysis of its characteristics, structure, function, and research applications.

3.1. Mechanosensitive Gating

MscL activates in response to membrane tension caused by hypoosmotic shock, opening a non-selective pore (~3 nS conductance) to release small solutes (e.g., ions, amino acids) . Key functional features include:

PropertyValue
Conductance~3 nS (similar to EcMscL)
Pore Diameter~30 Å (estimated)
Gating ThresholdNear-lytic membrane tension
InhibitorsGadolinium (0.1 mM blocks activity)

3.2. Role in Osmoregulation

MscL acts as a “last-resort” safety valve in bacteria, preventing cell lysis under extreme osmotic stress. Functional studies in E. coli show that MscL-deficient strains lyse during hypoosmotic shock, while MscL-expressing strains survive . The Psychrobacter homolog likely serves a similar role in its psychrophilic environment.

4.2. Drug Interactions

MscL is a target for antimicrobial compounds:

  • Dihydrostreptomycin (DHS) binds near the TM1-TM2 interface, partially opening the pore and enabling antibiotic influx .

  • Ramizol and IRS-16 reduce MscL gating thresholds, inducing membrane permeabilization .

Comparative Analysis with Homologs

The Psychrobacter cryohalolentis MscL differs from other homologs in:

FeaturePsychrobacter cryohalolentis MscL EcMscL MscMJLR (M. jannaschii)
Conductance~3 nS~3 nS~2 nS
Activation Energy~18 kT (inferred)~18 kT~6 kT
Pore RectificationNot reportedNon-rectifyingOutward rectification

6.1. Recombinant Expression

  • Host: E. coli .

  • Purification: Ni-NTA affinity chromatography (His-tag) .

  • Stability: Lyophilized powder stored at -20°C/-80°C; avoid repeated freeze-thaw cycles .

6.2. Functional Reconstitution

Reconstituted into liposomes or spheroplasts, the channel retains activity, as confirmed by:

  • Light scattering assays: Detects osmolyte release kinetics .

  • Patch-clamp recordings: Validates pressure-dependent gating .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Pcryo_0374; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Psychrobacter cryohalolentis (strain K5)
Target Names
mscL
Target Protein Sequence
MSMVSEFKEFALKGNVMDLAVGVIIGGAFATITKSLVEDVIMPIVAFIVGGEINFKNMFL ILGDAPEGVARTNDALKAAGIPVLAYGSFITVLINFLILAFIIFMMVKMVNRLRRADEVE EAIEEAIEEPSEEVQLLREISAKLGNINK
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Psychrobacter cryohalolentis and why is it of interest for MscL research?

Psychrobacter cryohalolentis is a Gram-negative bacterium first isolated in 2006 from a Siberian permafrost cryopeg, which is a permanently cold, salty environment . This psychrotolerant organism has garnered significant scientific interest due to its remarkable adaptability to extreme environmental conditions, including high salt concentrations, low temperatures, high desiccation, and even survival under simulated Martian surface conditions .

The large-conductance mechanosensitive channel (MscL) from P. cryohalolentis represents a particularly valuable research target because it must function under extreme conditions where membrane fluidity and cellular physiology are significantly altered. Understanding how this channel operates in such environments could provide critical insights into membrane protein evolution in extremophiles, mechanisms of osmotic regulation in psychrotolerant bacteria, and biomolecular adaptations for functioning at low temperatures.

P. cryohalolentis has been isolated from various environments and is considered an opportunistic pathogen, with related strains having been found in human clinical samples including blood, cerebrospinal fluid, and urine . This clinical relevance adds another dimension to the importance of understanding its cellular physiology and membrane protein function.

Research on P. cryohalolentis MscL typically employs recombinant expression systems, often using E. coli as the host organism, followed by detailed functional and structural characterization to elucidate its unique properties and adaptations.

  • What are mechanosensitive channels and what is their function in bacteria?

Mechanosensitive channels are specialized membrane proteins that respond to mechanical forces in the cell membrane, particularly those caused by osmotic pressure changes. In bacteria, these channels play crucial roles in osmoregulation and protection against osmotic shock, serving as emergency release valves that prevent cellular rupture.

The large-conductance mechanosensitive channel (MscL) is particularly important during hypoosmotic shock—when the external environment suddenly becomes less concentrated than the cytoplasm. When this occurs, water rapidly enters the cell due to osmotic pressure, creating tension in the cell membrane. MscL channels sense this tension and open, allowing the rapid efflux of small solutes and water, thereby reducing internal pressure and preventing cell lysis.

MscL has several key characteristics that make it an effective emergency valve:

  • Large pore size (approximately 30 Å when fully open)

  • Non-selective permeability to ions and small molecules

  • Activation threshold typically around 10-12 mN/m membrane tension

  • Pentameric structure in most bacteria studied to date

In P. cryohalolentis, MscL would be especially important for surviving the freeze-thaw cycles and salt concentration fluctuations that occur in its natural permafrost habitat . The channel likely has evolved specific adaptations that allow it to function effectively at low temperatures and in high salt conditions characteristic of its native environment.

For researchers studying bacterial MscL function, common experimental approaches include patch-clamp electrophysiology, osmotic shock survival assays, and fluorescent dye release experiments, all of which can be adapted to examine the unique properties of P. cryohalolentis MscL.

  • What techniques are commonly used to express recombinant P. cryohalolentis MscL?

Expression of recombinant P. cryohalolentis MscL requires specialized techniques that accommodate both its membrane protein nature and its psychrotolerant origin. The following approaches are typically employed:

Expression Systems:

  • E. coli Expression Systems: The most common approach uses E. coli strains optimized for membrane protein expression such as:

    • C41(DE3) or C43(DE3) strains (Walker strains)

    • BL21(DE3) with pLysS for tighter expression control

    • Lemo21(DE3) for tunable expression levels

  • Cell-Free Expression Systems: For difficult-to-express membrane proteins, cell-free systems supplemented with lipids or detergents represent an alternative approach.

Expression Vectors:

  • pET series vectors with T7 promoter for high-level expression

  • Vectors containing fusion tags to aid in purification and solubility (His6, MBP, GST)

  • Low-copy number vectors for reduced expression level and toxicity

Induction and Growth Conditions:
Since P. cryohalolentis is psychrotolerant (growing at temperatures between -10°C to 30°C) , specialized expression conditions often include:

  • Lower induction temperatures (16-20°C) to improve folding

  • Extended expression times (overnight or longer)

  • Specialized media compositions that mimic aspects of the organism's natural environment

Methodological Workflow:

  • Clone the P. cryohalolentis mscL gene into an appropriate expression vector

  • Transform into the chosen E. coli expression strain

  • Grow cells to optimal density (typically mid-log phase, OD600 ≈ 0.6-0.8)

  • Induce expression (with IPTG for T7-based systems)

  • Continue growth at reduced temperature

  • Harvest cells and extract membranes

  • Solubilize MscL using appropriate detergents

  • Purify using affinity chromatography and size exclusion chromatography

Special considerations must be made for the cold adaptation of P. cryohalolentis proteins, which may necessitate lower temperatures during purification steps. Additionally, the high salt tolerance of the organism suggests its proteins may require higher salt concentrations during purification to maintain stability and native conformation.

  • What are the optimal growth conditions for P. cryohalolentis?

P. cryohalolentis has specific growth requirements that reflect its adaptation to permanently cold, salty environments. Understanding these conditions is crucial for both organism cultivation and optimizing recombinant protein expression:

Temperature Range:

  • Psychrotolerant: Can grow at low temperatures but also tolerates moderate temperatures

  • Growth temperature range: Approximately -10°C to 30°C

  • Optimal growth temperature: Around 20-22°C

Media Composition:

  • Marine or halophilic bacterial growth media are typically suitable

  • Common media choices include Marine Broth or Psychrobacter-specific media

  • NaCl requirements: Typically 1-7% (w/v), reflecting its halotolerant nature

Atmospheric Conditions:

  • Aerobic growth conditions are required

  • Standard atmospheric pressure is suitable for laboratory cultivation, though the organism shows survival capability at reduced pressures

pH Requirements:

  • Typically neutral to slightly alkaline (pH 7.0-8.0)

Growth Kinetics:
Due to its psychrotolerant nature, P. cryohalolentis exhibits:

  • Slower growth rates compared to mesophilic bacteria

  • Longer lag phases, particularly at lower temperatures

  • Extended stationary phases

Special Considerations:
Research indicates that P. cryohalolentis can survive in extreme conditions, including:

  • Desiccation (particularly when embedded within a medium/salt matrix)

  • Low atmospheric pressure (7.1 mbar in Mars simulation studies)

  • Exposure to simulated Martian conditions (limited survival under UV shielding)

These unique growth characteristics must be taken into account when designing experiments involving P. cryohalolentis or when expressing its proteins in heterologous systems. For recombinant MscL expression specifically, these growth conditions would need to be modified to accommodate the expression system being used while maintaining conditions that promote proper protein folding.

Advanced Research Questions

  • What are the challenges in purifying functional recombinant P. cryohalolentis MscL?

Purifying functional recombinant P. cryohalolentis MscL presents several specific challenges stemming from both its nature as a membrane protein and the psychrotolerant origin of the organism:

Membrane Protein-Specific Challenges:

  • Solubilization Efficiency: Selecting detergents that efficiently extract MscL from membranes while maintaining its native conformation is critical. Common approaches include:

    • Screening multiple detergents (DDM, OG, LDAO, etc.)

    • Using detergent mixtures or novel amphipols

    • Testing solubilization at different temperatures (4-20°C)

  • Protein Stability: Membrane proteins often destabilize when removed from the lipid bilayer. Strategies to address this include:

    • Adding specific lipids during purification (POPE, POPG)

    • Using stabilizing additives (glycerol, specific ions)

    • Employing lipid nanodiscs or liposome reconstitution

Psychrotolerant-Specific Challenges:

  • Temperature Considerations: As a protein from a cold-adapted organism, P. cryohalolentis MscL may denature at higher temperatures typically used in purification:

    • Purification should be conducted at lower temperatures (4-15°C)

    • Heat steps commonly used in purification protocols should be avoided

    • Activity assays should include tests at lower temperatures

  • Salt Requirements: Given the halotolerant nature of P. cryohalolentis , its MscL may have specific salt requirements:

    • Purification buffers may require higher salt concentrations

    • Activity might be salt-dependent in functional assays

    • The protein might aggregate in low-salt conditions

Functional Verification Challenges:

  • Activity Assessment: Verifying that purified MscL retains its native function is challenging:

    • Patch-clamp electrophysiology requires reconstitution in liposomes or planar lipid bilayers

    • Fluorescent dye release assays need careful calibration

    • In vivo complementation assays require proper expression in a suitable host

A typical purification protocol might involve membrane isolation by ultracentrifugation, detergent screening at 4°C, IMAC purification, and size exclusion chromatography, followed by functional testing in liposome reconstitution systems. Multiple conditions should be tested in parallel, with functional assays performed at various temperatures relevant to the organism's natural environment.

  • How can we measure the electrophysiological properties of P. cryohalolentis MscL?

Measuring the electrophysiological properties of P. cryohalolentis MscL requires specialized techniques that enable the assessment of channel activity under controlled conditions. Several key methodological approaches are particularly valuable:

Patch-Clamp Electrophysiology:
This gold standard technique for characterizing mechanosensitive channels involves:

  • System Preparation:

    • Reconstituting purified MscL into liposomes of defined lipid composition

    • Forming GΩ seals between patch pipette and liposome membrane

    • Applying controlled suction to the patch pipette to create membrane tension

  • Key Measurements:

    • Single-channel conductance (typically 1-3 nS for bacterial MscL)

    • Gating threshold (membrane tension required for channel opening)

    • Open probability as a function of membrane tension

    • Channel kinetics (opening and closing rates)

    • Subconductance states (partially open states)

  • Temperature Considerations:

    • For P. cryohalolentis MscL, patch-clamp apparatus should ideally allow measurements at low temperatures (5-20°C)

    • Comparative measurements at different temperatures to assess thermosensitivity

Fluorescent Dye Release Assays:
A complementary approach for assessing channel function in reconstituted systems:

  • Protocol:

    • Prepare liposomes containing purified MscL and fluorescent dye (calcein, HPTS, etc.)

    • Apply osmotic downshock or amphipaths to activate channels

    • Monitor dye release via fluorescence spectroscopy

  • Data Analysis:

    • Calculate percent dye release relative to total release (via detergent)

    • Determine EC50 for activation by different stimuli

    • Measure kinetics of dye release

Stopped-Flow Spectroscopy:
For rapid kinetic analysis of MscL-mediated flux:

  • Setup:

    • Rapidly mix proteoliposomes with hypoosmotic solution

    • Monitor light scattering or fluorescence changes over millisecond timescale

  • Analysis:

    • Determine rate constants for channel activation

    • Compare with other MscL proteins (e.g., E. coli MscL)

A typical electrophysiological characterization dataset might be presented as follows:

PropertyP. cryohalolentis MscLE. coli MscL (reference)
Single-channel conductance[X] nS3.2 nS
Gating threshold at 20°C[Y] mN/m10-12 mN/m
Gating threshold at 5°C[Z] mN/mNot applicable
Open dwell time[A] ms20-30 ms
Subconductance states[Number observed]3-4 states
Temperature sensitivity[Observation]Minimal

These methodologies, particularly when applied across a range of temperatures relevant to P. cryohalolentis' natural habitat, provide critical insights into the channel's adaptation to extreme environments.

  • What role might MscL play in P. cryohalolentis' adaptation to extreme environments?

P. cryohalolentis has demonstrated remarkable survival capabilities in extreme conditions, including permafrost environments, high salt concentrations, desiccation, and even simulated Martian conditions . The MscL channel likely plays several critical roles in these adaptations:

Cold Temperature Adaptation:

  • Membrane Fluidity Compensation:

    • At low temperatures, cellular membranes become more rigid

    • MscL in P. cryohalolentis may have evolved a lower gating threshold to function in more rigid membranes

    • Potential structural adaptations include altered hydrophobic interactions in the transmembrane domains

  • Freeze-Thaw Survival:

    • During freezing, extracellular ice formation creates osmotic stress on cells

    • MscL may act as a regulated valve during thawing, preventing osmotic lysis

    • The channel could have specialized kinetics optimized for freeze-thaw cycles

Desiccation Resistance:
The search results indicate that P. cryohalolentis shows enhanced survival during desiccation when embedded in a medium/salt matrix (MSM) :

  • Osmotic Regulation During Rehydration:

    • MscL would be critical during rehydration after desiccation

    • Controlled solute release prevents cellular damage from rapid water influx

    • The channel may have adaptations for repeated dehydration-rehydration cycles

  • Interaction with Compatible Solutes:

    • P. cryohalolentis likely accumulates compatible solutes for osmotic protection

    • MscL may be regulated by or interact with these specific solutes

    • This could provide fine-tuned osmoregulation in fluctuating environments

Salt Tolerance:
As a halotolerant organism from a cryopeg (cold, salty environment) :

  • Salt-Dependent Gating Properties:

    • MscL may have evolved altered sensitivities to ionic strength

    • The channel could show optimized function in high-salt conditions

    • Electrostatic interactions at the protein-lipid interface might be modified

Experimental studies to investigate these adaptations might include MscL knockout studies, complementation experiments with MscL variants, and comparative analyses between P. cryohalolentis MscL and mesophilic homologs. The remarkable ability of P. cryohalolentis to survive under simulated Martian conditions suggests that its cellular stress response systems, including MscL, have broad adaptability to multiple extreme conditions.

  • What mutagenesis approaches are effective for studying P. cryohalolentis MscL function?

Several mutagenesis approaches can be employed to study P. cryohalolentis MscL function, each with specific advantages for addressing different research questions:

Site-Directed Mutagenesis:
For targeted modification of specific amino acids:

  • Strategic Target Sites:

    • Pore-lining residues (to alter conductance or selectivity)

    • Transmembrane domain interfaces (to modify gating threshold)

    • Cytoplasmic and periplasmic domains (to investigate regulatory regions)

  • Protocol Considerations:

    • PCR-based methods using complementary mutagenic primers

    • Gibson Assembly for more complex modifications

    • Golden Gate assembly for multiple simultaneous mutations

  • Experimental Design:

    • Create a series of single mutations along functional domains

    • Generate conservative and non-conservative substitutions

    • Develop mutations that mimic mesophilic MscL residues to identify cold-adaptation features

Transposon Mutagenesis:
As mentioned in the search results , tri-parental conjugation can be used for transposon mutagenesis in P. cryohalolentis:

  • Advantages for MscL Studies:

    • Identification of genes that interact with mscL or affect its function

    • Discovery of regulatory elements controlling mscL expression

    • Creation of mscL knockout for phenotypic analysis

  • Protocol Highlights:

    • Tri-parental conjugation using E. coli donor and helper strains

    • Selection of transposon insertion mutants on appropriate media

    • Screening for altered osmotic shock sensitivity

Chimeric Protein Construction:
To identify domain-specific adaptations:

  • Design Strategy:

    • Swap domains between P. cryohalolentis MscL and mesophilic homologs

    • Create chimeras with varying proportions of each protein

    • Focus on transmembrane domains, loops, and terminal regions separately

  • Functional Analysis:

    • Electrophysiological characterization

    • Temperature-dependent activity assays

    • In vivo complementation tests

When planning mutagenesis studies, researchers might consider the following decision framework:

Research QuestionPrimary Mutagenesis ApproachSecondary ApproachKey Controls
Gating mechanismSite-directed (pore and TM residues)Cysteine scanningWild-type and E. coli MscL
Cold adaptationChimeric constructsSite-directedFunctional assays at multiple temperatures
Regulatory interactionsTransposon mutagenesisRandom mutagenesisComplementation tests
Structure-functionAlanine scanningSite-directedConductance and threshold measurements

This multifaceted approach to mutagenesis allows for comprehensive investigation of P. cryohalolentis MscL structure-function relationships and adaptation mechanisms.

  • How does the structure of P. cryohalolentis MscL relate to its function in osmotic regulation?

While specific structural information about P. cryohalolentis MscL is not provided in the search results, we can discuss the structure-function relationship based on known bacterial MscL channels and the expected adaptations in a psychrotolerant organism:

General MscL Structural Elements and Their Functions:

  • Transmembrane Domains:

    • TM1: Forms the pore lining with a hydrophobic constriction site that creates the channel gate

    • TM2: Interacts with the membrane and transmits tension forces to the gate

    • Function: The hydrophobic interactions between TM1 helices maintain channel closure until sufficient membrane tension is applied

  • Periplasmic Loop:

    • Connects TM1 and TM2

    • Function: Acts as a spring element during channel opening, influencing gating kinetics

  • Cytoplasmic Helical Bundle:

    • C-terminal domain forming a pentameric assembly

    • Function: Stabilizes the closed state and may interact with cytoplasmic elements

Predicted Adaptations in P. cryohalolentis MscL:

  • Cold-Adaptive Features:

    • Increased flexibility in key domains to maintain function at low temperatures

    • Modified hydrophobic gating region with potentially reduced hydrophobicity

    • Altered charge distribution to compensate for decreased membrane fluidity

    • Potential reduction in strong interaction networks that might restrict movement at low temperatures

  • Halotolerance Adaptations:

    • Modified surface charge distribution to function in high-salt environments

    • Potentially altered ion coordination sites within the pore

    • Adaptations for functioning in membranes with altered lipid composition due to salt stress

Structure-Based Gating Mechanism:

  • Tension Sensing:

    • Membrane tension is transmitted to the channel via TM2-lipid interactions

    • In P. cryohalolentis, this mechanism might be calibrated to function in more rigid membranes

A proposed structure-function model of P. cryohalolentis MscL might include:

Structural FeatureStandard MscL FunctionPredicted P. cryohalolentis AdaptationFunctional Consequence
Hydrophobic gateStrong hydrophobic interactions maintain closureReduced hydrophobicityLower gating threshold at cold temperatures
TM2-lipid interfaceSenses membrane tensionModified hydrophobic matchingOptimized sensing in cold, rigid membranes
Periplasmic loopProvides flexibility during gatingIncreased flexibilityMaintains function at low temperatures
C-terminal bundleStabilizes closed stateModified inter-subunit interactionsPrevents over-stabilization at low temperatures

Research approaches to study these structure-function relationships include molecular dynamics simulations, cryo-EM analysis (particularly appropriate for a cold-adapted protein), and site-directed mutagenesis followed by electrophysiological characterization.

  • What are the best experimental controls when working with recombinant P. cryohalolentis MscL?

When designing experiments with recombinant P. cryohalolentis MscL, robust controls are essential for valid interpretation of results. The following experimental controls should be considered:

Positive Controls:

  • Well-Characterized MscL Homologs:

    • E. coli MscL as the gold standard reference

    • Purpose: Provides comparison to a well-studied channel

    • Implementation: Express and purify in parallel with P. cryohalolentis MscL

    • Analysis: Compare functional parameters (conductance, threshold, kinetics)

  • Known MscL Modulators:

    • Amphipaths like lysophosphatidylcholine (LPC) that activate MscL

    • Purpose: Verifies channel functionality

    • Implementation: Apply to reconstituted channels during electrophysiology

    • Expected outcome: Channel activation regardless of membrane tension

Negative Controls:

  • Non-Functional MscL Mutants:

    • Create gain-of-function and loss-of-function mutations in P. cryohalolentis MscL

    • Purpose: Establish boundaries of channel behavior

    • Implementation: Parallel testing with wild-type channel

    • Analysis: Confirms that observed activity is specific to functional channel

  • Empty Expression Vector:

    • Host cells transformed with expression vector lacking mscL gene

    • Purpose: Controls for host cell background activity

    • Implementation: Process identically to MscL-expressing cells

    • Analysis: Ensures observed effects are due to MscL presence

System Controls:

  • Temperature Controls:

    • Perform experiments at multiple temperatures (4°C, 20°C, 37°C)

    • Purpose: Assess temperature-dependency of channel function

    • Implementation: Maintain consistent conditions except temperature

    • Analysis: Reveals cold-adaptive properties of P. cryohalolentis MscL

  • Membrane Composition Controls:

    • Vary lipid composition in reconstitution experiments

    • Purpose: Determine lipid-dependency of channel function

    • Implementation: Test different lipid mixtures (PE:PG ratios, cholesterol content)

    • Analysis: Identifies optimal membrane environment for functionality

When designing specific experiments, researchers should implement this control selection framework:

Experiment TypeEssential ControlsRecommended ControlsData Validation Method
ElectrophysiologyE. coli MscL, non-functional mutantTemperature series, lipid variationsStatistical comparison of multiple patches
Osmotic shock survivalEmpty vector, complemented knockoutGrowth curve at multiple temperaturesSurvival ratio calculations with multiple replicates
Protein purificationE. coli MscL purified in parallelDetergent screen, stability assaysSEC profile comparison, functional testing

These comprehensive controls ensure that experimental observations can be attributed specifically to P. cryohalolentis MscL properties rather than artifacts or system variables.

  • How can we assess the impact of environmental factors on P. cryohalolentis MscL activity?

Assessing the impact of environmental factors on P. cryohalolentis MscL activity requires multifaceted experimental approaches that simulate the extreme conditions this psychrotolerant organism naturally encounters. Based on the search results describing P. cryohalolentis survival in extreme conditions , the following methodologies are appropriate:

Temperature Effects Assessment:

  • Electrophysiological Characterization Across Temperatures:

    • Patch-clamp analysis of reconstituted channels at temperatures from 0°C to 30°C

    • Parameters to measure: conductance, gating threshold, open probability, kinetics

    • Data analysis: Calculate Q10 values for different parameters

    • Expected outcomes: Potential identification of temperature-dependent gating mechanisms

  • Thermal Stability Analysis:

    • Differential scanning calorimetry of purified protein

    • Circular dichroism spectroscopy at varying temperatures

    • Intrinsic fluorescence measurements during thermal ramping

    • Analysis: Determine melting temperatures (Tm) and unfolding profiles

Osmotic Stress Response:

  • Hypoosmotic Shock Survival Assays:

    • Express P. cryohalolentis MscL in E. coli MscL-knockout strain

    • Subject cells to osmotic downshock at different temperatures

    • Measure survival rates and recovery kinetics

    • Controls: E. coli MscL-complemented cells, empty vector controls

  • Mechanosensitive Channel Activity Assays:

    • Reconstitute MscL in liposomes loaded with fluorescent dye

    • Apply controlled osmotic gradients

    • Monitor dye release as function of osmotic pressure

    • Analyze: Determine osmotic activation threshold at different temperatures

Salt Concentration Effects:

  • Functional Analysis in Varying Ionic Strengths:

    • Electrophysiological recording in solutions of different salt concentrations

    • Parameters: single-channel conductance, ion selectivity, gating properties

    • Analysis: Determine salt-dependency of channel function

    • Controls: Measure effects on E. coli MscL for comparison

Desiccation and Rehydration Effects:

  • Channel Activity Following Desiccation-Rehydration Cycles:

    • Prepare proteoliposomes with reconstituted MscL

    • Subject to controlled desiccation with/without medium/salt matrix (MSM)

    • Rehydrate under defined conditions

    • Measure residual channel activity

    • Analysis: Compare activity preservation with/without MSM protection

A comprehensive analysis might generate data that could be presented as follows:

Environmental FactorParameter RangePrimary Effect on MscLSecondary EffectsInteraction Effects
Temperature0°C to 30°C[Gating threshold changes][Kinetic alterations][Synergy with salt concentration]
Salt concentration0% to 10% NaCl[Conductance impacts][Stability effects][Modifies temperature response]
Desiccation0% to 90% RH[Rehydration response][Conformational changes][Enhanced by MSM presence]
Pressure7.1 mbar to 1 atm[Activation threshold shifts][Expression level impacts][Interacts with temperature effects]

These multifaceted approaches would provide a comprehensive understanding of how P. cryohalolentis MscL has adapted to function in extreme environments and how environmental factors modulate its activity, building upon the organism's demonstrated survival capabilities under simulated Martian conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.