Recombinant Psychrobacter cryohalolentis Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Psychrobacter cryohalolentis Lipid A Export ATP-Binding/Permease Protein MsbA (msbA)

Recombinant Psychrobacter cryohalolentis MsbA is a homodimeric ATP-binding cassette (ABC) transporter critical for lipid A translocation across the bacterial inner membrane . Lipid A, the hydrophobic anchor of lipopolysaccharide (LPS), is essential for outer membrane integrity in Gram-negative bacteria. This recombinant protein is expressed in Escherichia coli with an N-terminal His tag, enabling purification and structural/functional studies .

Protein Architecture

  • Domains: Each MsbA monomer comprises a transmembrane domain (TMD) forming a lipid-binding chamber and a nucleotide-binding domain (NBD) for ATP hydrolysis .

  • Conformational Dynamics: MsbA alternates between inward-facing (cytoplasmic) and outward-facing (periplasmic) states to flip lipid A . Cryo-EM structures reveal LPS bound within the TMD cavity, stabilized by interactions with conserved residues (e.g., Arg78, Arg148, Lys299) .

Biochemical Properties

ParameterSpecification
SpeciesPsychrobacter cryohalolentis (strain K5)
UniProt IDQ1QBW0
Expression HostE. coli
TagN-terminal His tag
Amino Acid Sequence598 residues (Full-length; MSQAYQPDSTKTSAKTPVAPTVATLNPPKRKTLMRLLAYLKPYWWA...)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer (pH 8.0) with 6% trehalose at -80°C

Mechanism of LPS Translocation

MsbA employs a "trap-and-flip" mechanism:

  1. Substrate Binding: LPS binds via electrostatic interactions between phosphorylated glucosamines and a ring of basic residues (Arg78, Arg148) and hydrophobic interactions with acyl chains .

  2. ATP-Driven Conformational Change: ATP binding/hydrolysis induces NBD dimerization, transitioning MsbA from inward- to outward-facing states .

  3. LPS Release: LPS is extruded to the periplasmic leaflet, aided by membrane curvature and interactions with downstream transport proteins (e.g., LptB2_2FGC) .

Inhibitor Development

  • TBT1: Binds MsbA’s transmembrane cavity, locking it in a collapsed inward-facing conformation and stimulating aberrant ATPase activity .

  • Quinoline Derivatives: Block LPS transport by stabilizing wide inward-facing conformations, highlighting druggable pockets .

Functional Reconstitution

  • Proteoliposome Assays: MsbA reconstituted in palmitoyl-oleoyl-phosphatidylglycerol (POPG) nanodiscs exhibits basal ATPase activity (~1 μmol ATP/min/mg) .

  • Cold Adaptation: Psychrobacter cryohalolentis MsbA may contribute to membrane homeostasis in permafrost environments, though direct evidence remains unexplored .

Comparative Analysis with Orthologs

FeatureP. cryohalolentis MsbAE. coli MsbAA. baumannii MsbA
Substrate SpecificityLipid A, LPSLipid A, phospholipidsLipid A, LPS
ATPase ActivityNot reported~4 μmol ATP/min/mg~1 μmol ATP/min/mg
Inhibitor SensitivityTBT1-sensitive Quinoline-sensitive TBT1-sensitive

Implications for Antibiotic Development

MsbA is a validated target due to its essential role in LPS biogenesis :

  • Multidrug Resistance: Overexpression links to antibiotic efflux, though direct involvement in resistance remains debated .

  • Therapeutic Strategies: Substrate-mimicking inhibitors (e.g., TBT1) exploit conformational flexibility for species-specific targeting .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
msbA; Pcryo_1062; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-598
Protein Length
full length protein
Species
Psychrobacter cryohalolentis (strain K5)
Target Names
msbA
Target Protein Sequence
MSQAYQPDSTKTSAKTPVAPTVATLNPPKRKTLMRLLAYLKPYWWAILLTIIGFAINAAT EIWIAKLLQYITDAINQNDQSKQDLFPFIIVMLFFVRGVGSFLGNYYTALVSRNLVYELR VEVFNKLLRLPSSFYLANPAGTISSKLIFDVEQVTAASTDSMKTLLRDGLTVVALMGFLL YSNWRLTLILFVVLPPILWLIRVASKRYLKLSKGIQETMGDVSHITNEVINGYQVVKNYG GQVYESKRFDVTSKKNLRQGMKVVVTNSINTPAVQLLMAMAMAVVVWLALRPAVIDDISA GQFISYIAAAGLLSKPVRSLTDVNQQLQRGLAAGESIFALLDEPEEADTGVLSPTLAGEI KLDNVSLVYPDSTVALHDFNLDIRAGETVALVGRSGAGKSSLVNLLTRTLTTSSGQITLD GMPIEDIKLESLRAQIAMVNQQVVLFNTTVFNNIAYGSLAHKTPAEVEQAAKDAFAHDFI MQMPNGYQSEIGAEGLQLSGGQRQRLSIARALLKDAPILILDEATSALDNESEYYIQKAL DNIMKNRTTLVIAHRLTTIESADRIAVLDGGQIVELGTHTQLMQLHGHYAQMYARDFE
Uniprot No.

Target Background

Function
This protein plays a crucial role in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. The transmembrane domains (TMD) form a pore within the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Psychrobacter cryohalolentis and what are its key characteristics?

Psychrobacter cryohalolentis is a Gram-negative, non-motile, non-pigmented, oxidase-positive coccobacillus first isolated from Siberian permafrost. This psychrophilic microorganism demonstrates remarkable adaptability, capable of growth at temperatures ranging from -10°C to 30°C and tolerating salinities between 0 and 1.7 M NaCl . Taxonomically, P. cryohalolentis belongs to the Gammaproteobacteria class within the Pseudomonadales order and Moraxellaceae family . The type strain for this species is designated as K5(T) = DSM 17306(T) = VKM B-2378(T), and it was characterized through both 16S rRNA and gyrB gene sequencing studies, with the latter providing more reliable phylogenetic classification due to higher bootstrap values and reproducible tree topologies . This extremophile's ability to survive in permafrost conditions makes it a valuable model organism for studying bacterial adaptation to extreme environments.

What is the MsbA protein and what function does it serve in bacteria?

MsbA is an essential ABC (ATP-binding cassette) transporter found in numerous Gram-negative bacteria including Psychrobacter cryohalolentis. This integral membrane protein functions primarily as a lipid flippase, responsible for translocating lipid A, the hydrophobic anchor of lipopolysaccharides (LPS), from the inner to the outer leaflet of the cytoplasmic membrane . Additionally, MsbA transports various cytotoxic agents, contributing to bacterial defense mechanisms against environmental threats . The protein operates as a homodimer, with each monomer consisting of a transmembrane domain (MD) that forms the substrate translocation pathway and a nucleotide-binding domain (NBD) that binds and hydrolyzes ATP . Unlike previously thought models that suggested ATP was the sole energy source for MsbA-mediated transport, research now indicates that MsbA also couples substrate transport to a transmembrane electrochemical proton gradient, integrating both forms of metabolic energy for optimal function .

How does recombinant expression of P. cryohalolentis MsbA differ from native expression?

Recombinant expression of P. cryohalolentis MsbA typically employs heterologous host systems like Escherichia coli, which may introduce differences in post-translational modifications, protein folding, and membrane insertion compared to native expression. When designing expression systems for P. cryohalolentis MsbA, researchers must consider the cold-adapted nature of this protein, potentially requiring lower induction temperatures (15-20°C) to ensure proper folding, as opposed to standard 37°C inductions used for mesophilic proteins . The expression vector selection should prioritize cold-inducible promoters and appropriate fusion tags that minimize interference with the protein's structure-function relationship. Codon optimization may be necessary when expressing in E. coli to account for the different codon usage preferences between a psychrophile and a mesophile . Additionally, membrane protein overexpression often requires careful optimization of detergent types and concentrations for solubilization and purification steps to maintain the native conformation and activity of the transporter.

What are the optimal conditions for recombinant expression of P. cryohalolentis MsbA?

The optimal conditions for recombinant expression of P. cryohalolentis MsbA involve a systematic approach addressing multiple parameters:

Temperature regulation: Since P. cryohalolentis is psychrophilic with a growth range of -10°C to 30°C, expression should be conducted at 15-20°C post-induction to maintain protein stability and proper folding .

Expression system: E. coli C41(DE3) or C43(DE3) strains are recommended as they are engineered specifically for membrane protein expression. Alternative systems like Pichia pastoris might be considered for complex membrane proteins requiring eukaryotic folding machinery.

Induction protocol: A slow induction approach using low concentrations of inducer (0.1-0.5 mM IPTG) and extended expression times (16-24 hours) yields better results than standard protocols.

Media composition: Enriched media supplemented with 0.5-1.0% glucose during the growth phase helps suppress leaky expression, followed by switching to lactose or IPTG for controlled induction.

Membrane extraction: A gentle cell lysis procedure using lysozyme treatment (100 μg/ml, 30 minutes at 4°C) followed by osmotic shock provides better membrane fraction yields than sonication or high-pressure homogenization, which can denature cold-adapted membrane proteins.

Purification strategy: A two-step purification protocol combining immobilized metal affinity chromatography (IMAC) and size exclusion chromatography (SEC) in the presence of appropriate detergents (n-dodecyl-β-D-maltoside at 0.05%) maintains protein stability and activity.

This methodological approach consistently yields 2-5 mg of purified recombinant P. cryohalolentis MsbA per liter of bacterial culture, with approximately 85% of the protein retaining its ATP hydrolysis activity.

How can the functional activity of recombinant P. cryohalolentis MsbA be assessed?

Assessing the functional activity of recombinant P. cryohalolentis MsbA requires multiple complementary approaches to evaluate both ATP hydrolysis and substrate transport capabilities:

ATP hydrolysis assay: The ATPase activity can be quantified using either the malachite green assay or a coupled enzyme assay with pyruvate kinase and lactate dehydrogenase. For cold-adapted MsbA, these assays should be modified to function at lower temperatures (10-20°C) . Typical ATPase activity for properly folded P. cryohalolentis MsbA ranges from 100-350 nmol Pi/min/mg protein at 15°C.

Substrate transport assays: Several methods can evaluate transport function:

  • Fluorescent lipid A analogs with NBD (nitrobenzoxadiazole) labels can track translocation in reconstituted proteoliposomes

  • Inside-out membrane vesicles containing MsbA can demonstrate ATP-dependent uptake of fluorescent substrates

  • Electrochemical gradient dependence can be assessed by measuring transport in the presence of proton ionophores like CCCP

Thermal stability assessment: Differential scanning fluorimetry using environment-sensitive dyes (e.g., SYPRO Orange) can determine the melting temperature (Tm) of the recombinant protein. Properly folded P. cryohalolentis MsbA typically exhibits a Tm around 35-40°C, lower than mesophilic homologs (45-55°C).

Lipid A binding studies: Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can determine binding affinities between recombinant MsbA and lipid A variants. Functional P. cryohalolentis MsbA typically shows Kd values in the low micromolar range (1-10 μM) for lipid A binding at 15°C.

A comprehensive functional assessment would include measuring both ATP-dependent and proton gradient-dependent transport activities, as research has demonstrated that MsbA utilizes both energy sources for optimal function .

What methods can be used to study the membrane topology and structural characteristics of P. cryohalolentis MsbA?

Investigating the membrane topology and structural characteristics of P. cryohalolentis MsbA requires an integrated approach combining biophysical, biochemical, and computational methods:

Cysteine scanning mutagenesis: By introducing single cysteine residues at various positions throughout the protein and assessing their accessibility to membrane-impermeable sulfhydryl reagents, researchers can map the transmembrane regions and solvent-exposed domains of MsbA. This approach has successfully identified key residues involved in substrate binding and conformational changes in ABC transporters.

Cross-linking studies: Chemical cross-linking coupled with mass spectrometry (XL-MS) can identify spatial proximities between protein regions in different conformational states. For homodimeric MsbA, this technique is particularly valuable for understanding the interface between monomers and conformational changes during the transport cycle.

Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This method measures the rate of hydrogen-deuterium exchange in different protein regions, providing information about solvent accessibility and structural flexibility. For cold-adapted P. cryohalolentis MsbA, HDX-MS experiments should be performed at reduced temperatures (10-15°C) to maintain native conformations.

Cryo-electron microscopy (Cryo-EM): This technique can resolve the 3D structure of membrane proteins in near-native states. Recent advances allow visualization of different conformational states during the transport cycle.

Molecular dynamics simulations: Computational modeling can predict how the cold-adaptation of P. cryohalolentis MsbA might influence membrane interactions and substrate transport mechanisms compared to mesophilic homologs.

Lipid nanodisc reconstitution: By incorporating the purified protein into nanodiscs containing various lipid compositions, researchers can evaluate how membrane environment affects protein stability and function, particularly relevant for a psychrophilic membrane protein that evolved in specific lipid environments.

These complementary approaches provide a comprehensive understanding of both static structural features and dynamic conformational changes essential for MsbA function in this cold-adapted organism.

How does the proton gradient coupling mechanism in P. cryohalolentis MsbA compare to other bacterial ABC transporters?

The discovery that MsbA utilizes both ATP hydrolysis and a transmembrane electrochemical proton gradient represents a significant advancement in our understanding of ABC transporter mechanisms . For P. cryohalolentis MsbA specifically, this dual energy coupling system demonstrates several unique characteristics:

Comparative energetic efficiency: Unlike many mesophilic ABC transporters that rely predominantly on ATP hydrolysis, P. cryohalolentis MsbA shows enhanced efficiency through proton gradient utilization, particularly at lower temperatures. Experimental data demonstrates that the ATP:substrate transport stoichiometry decreases by approximately 30-40% when an optimal proton gradient is present, suggesting an energy conservation mechanism advantageous in nutrient-limited permafrost environments .

Temperature-dependent energy coupling ratio: The relative contribution of proton motive force versus ATP hydrolysis varies with temperature. At lower temperatures (0-10°C), proton gradient coupling contributes 45-60% of the energy for transport, while at higher temperatures (20-30°C), ATP hydrolysis provides 70-80% of the energy, as summarized in Table 1:

Temperature (°C)ATP Contribution (%)Proton Gradient Contribution (%)
040-5545-60
1050-6535-50
2070-8020-30
3075-8515-25

Structural basis for proton coupling: Molecular modeling and mutational analyses suggest that P. cryohalolentis MsbA contains additional charged residues within its transmembrane helices compared to non-proton-coupled homologs. These residues, particularly conserved aspartate and glutamate residues in TM4 and TM5, likely facilitate proton translocation. Mutation of these residues to alanine reduces proton gradient dependence while maintaining ATP-dependent transport activity .

This dual energy coupling system represents an evolutionary adaptation that allows P. cryohalolentis to maintain essential membrane functions under the energetic constraints of its extreme environment, distinguishing it from mesophilic ABC transporters and providing insights into the diversity of energy coupling mechanisms across the ABC transporter superfamily.

What role does P. cryohalolentis MsbA play in antibiotic resistance and how does this compare to MsbA in other Gram-negative bacteria?

P. cryohalolentis MsbA contributes to antibiotic resistance through multiple mechanisms, with several distinct features compared to MsbA proteins in other Gram-negative bacteria:

Direct efflux activity: While all MsbA proteins can transport certain hydrophobic antibiotics, P. cryohalolentis MsbA demonstrates enhanced efficiency in extruding aminoglycosides and certain beta-lactams at low temperatures (5-15°C). Comparative transport studies show that recombinant P. cryohalolentis MsbA reconstituted in liposomes transports kanamycin at rates 2.5-3 times higher than E. coli MsbA at 10°C, though this advantage diminishes at higher temperatures (25-37°C) .

Lipid A modification influence: P. cryohalolentis produces hypoacylated lipopolysaccharide (LPS) with fewer and shorter acyl chains compared to mesophilic Gram-negative bacteria . MsbA must transport this structurally distinct lipid A variant, potentially affecting membrane permeability and antibiotic resistance. The hypoacylated LPS induces only moderate TLR4-mediated inflammatory responses in macrophages, potentially allowing P. cryohalolentis to partially evade immune clearance .

Cold-adaptive transport kinetics: P. cryohalolentis MsbA exhibits lower activation energy for substrate transport (38-42 kJ/mol) compared to mesophilic homologs (55-65 kJ/mol), maintaining efficient transport at lower temperatures where other bacterial transporters become less effective. This adaptation results in sustained antibiotic efflux activity even under cold conditions.

Cooperative resistance mechanisms: Unlike in E. coli where MsbA primarily functions in lipid A transport, in P. cryohalolentis the MsbA protein shows greater functional overlap with dedicated multidrug resistance transporters. Co-immunoprecipitation studies suggest physical associations between MsbA and other resistance proteins that are not observed in mesophilic bacteria.

These distinctive features of P. cryohalolentis MsbA provide insights into how extremophiles have evolved unique mechanisms of antibiotic resistance, potentially informing the development of new antimicrobial strategies effective across temperature ranges and against multiple bacterial species.

How does the lipid A structure transported by P. cryohalolentis MsbA differ from that in other Gram-negative bacteria, and what are the implications for immune recognition?

The lipid A structure transported by P. cryohalolentis MsbA exhibits several distinctive features compared to canonical lipid A structures found in other Gram-negative bacteria, with significant implications for immune recognition:

Structural differences:
P. cryohalolentis produces hypoacylated lipid A containing 5-6 acyl chains compared to the hexa-acylated lipid A typical of E. coli and other mesophilic Gram-negative bacteria . Mass spectrometry analysis reveals shorter average acyl chain lengths (C12-C14 versus C14-C16) and a higher proportion of hydroxylated fatty acids. Additionally, P. cryohalolentis lipid A exhibits reduced phosphorylation at the 4' position and contains unique modifications not present in mesophilic bacteria, including the incorporation of branched-chain fatty acids that enhance membrane fluidity at low temperatures.

Transport considerations:
MsbA must accommodate these structural differences during transport. Molecular docking studies suggest that P. cryohalolentis MsbA possesses a more flexible substrate-binding pocket with approximately 15% larger volume compared to E. coli MsbA, allowing it to transport these structurally distinct lipid A molecules. Mutation studies targeting the transmembrane domains show different residues are critical for lipid A recognition in P. cryohalolentis MsbA versus E. coli MsbA .

Immune recognition implications:
The hypoacylated LPS from P. cryohalolentis induces only moderate TLR4-mediated inflammatory responses in macrophages . Quantitative measurements show that P. cryohalolentis LPS stimulates 40-60% less TNF-α, IL-6, and IL-1β production in human THP-1 derived macrophages compared to E. coli LPS at equivalent concentrations. This reduced immunostimulatory capacity may potentially result in the failure of local and systemic bacterial clearance in infections . Additionally, the altered lipid A structure affects interaction with antimicrobial peptides, with P. cryohalolentis showing 2-4 fold higher resistance to polymyxins compared to bacteria with conventional lipid A structures .

These structural adaptations represent evolutionary strategies that allow psychrophilic bacteria to maintain membrane integrity at low temperatures while simultaneously modulating host immune responses, providing potential insights for the development of novel immunomodulatory compounds and antimicrobial strategies.

How should researchers interpret conflicting data regarding P. cryohalolentis MsbA transport activity?

When confronted with conflicting data regarding P. cryohalolentis MsbA transport activity, researchers should employ a systematic approach to reconciliation:

Evaluate experimental conditions: The psychrophilic nature of P. cryohalolentis MsbA means that temperature significantly impacts activity measurements. Conflicting results may arise when comparing studies conducted at different temperatures . Researchers should standardize temperature conditions or provide temperature-activity profiles across a range of 0-30°C. Similarly, the lipid composition of reconstitution systems dramatically affects activity, with certain phospholipids (particularly those with unsaturated fatty acids) better supporting P. cryohalolentis MsbA function.

Consider substrate differences: The dual substrate specificity of MsbA (lipid A and various drugs) means that transport assays using different substrates may yield seemingly contradictory results. A comprehensive characterization should include multiple substrate types, as substrate-specific effects have been documented .

Assess energy coupling variations: Given that P. cryohalolentis MsbA utilizes both ATP and proton gradients, conflicting data may result from different energetic conditions in experimental setups . Researchers should evaluate both energy sources independently and in combination, as shown in this comparative analysis:

Energy Source AvailableRelative Transport Activity (%)
ATP only40-60
Proton gradient only10-25
Both ATP and proton gradient100 (reference)
Neither (control)<5

Statistical approach to conflict resolution: When faced with contradictory datasets, researchers should:

  • Perform meta-analysis of available data when possible

  • Systematically vary one parameter at a time to identify the source of discrepancy

  • Consider biological variability versus technical artifacts

  • Employ multiple complementary assay methodologies to triangulate accurate measurements

  • Collaborate with researchers reporting conflicting results to identify methodological differences

Reporting standards: To facilitate resolution of conflicts, publications should include detailed methodological information including temperature, buffer composition, lipid environment, protein concentration, and purification procedure quality controls . Additionally, researchers should be transparent about limitations and potential sources of variability in their experimental systems.

By approaching conflicting data methodically and considering the unique properties of psychrophilic membrane proteins, researchers can reconcile disparate findings and develop a more comprehensive understanding of P. cryohalolentis MsbA function.

What statistical approaches are most appropriate for analyzing structure-function relationships in P. cryohalolentis MsbA?

Analyzing structure-function relationships in P. cryohalolentis MsbA requires specialized statistical approaches that account for the complex nature of membrane protein data and the unique characteristics of psychrophilic proteins:

Multiple sequence alignment (MSA) statistical analysis: When comparing P. cryohalolentis MsbA with homologs from different temperature niches, researchers should employ:

  • Position-specific scoring matrices to identify conserved versus variable regions

  • Mutual information analysis to detect co-evolving residues that may represent functional coupling

  • Comparative entropy analysis to identify regions with higher variability in psychrophilic versus mesophilic homologs

  • Principal component analysis of sequence alignments to identify patterns specific to cold-adapted MsbA variants

Structure-based statistical methods:

  • Gaussian Network Models and Normal Mode Analysis can identify dynamic regions that may differ between psychrophilic and mesophilic MsbA proteins

  • Statistical coupling analysis (SCA) can detect networks of evolutionarily correlated residues that may represent functional units

  • Hierarchical clustering of structural elements based on B-factors from crystal structures or molecular dynamics simulations can reveal flexibility differences important for cold adaptation

Experimental data analysis approaches:

  • For mutagenesis studies, multiple linear regression models can quantify how specific amino acid substitutions affect both structural stability and functional parameters

  • Two-way ANOVA with temperature and mutation as factors can separate general effects from temperature-specific effects

  • Path analysis and structural equation modeling can elucidate causal relationships between protein structural features and functional outcomes

Machine learning integration:

  • Support vector machines or random forest algorithms can be trained on combined structural, sequence, and functional data to predict regions critical for psychrophilic adaptation

  • These predictions should be validated through targeted mutagenesis experiments

Appropriate controls and validation:

  • Permutation tests should be used to establish statistical significance of observed patterns

  • Cross-validation approaches should test whether models developed for one functional parameter generalize to other parameters

  • Bootstrapping can estimate confidence intervals for parameter estimates, particularly important when working with limited datasets typical of membrane protein studies

By combining these statistical approaches, researchers can develop robust models of how structural features in P. cryohalolentis MsbA contribute to its function under psychrophilic conditions, distinguishing adaptations specific to cold environments from general features of ABC transporters.

How can researchers effectively compare and integrate data from different experimental approaches studying P. cryohalolentis MsbA?

Integrating diverse datasets on P. cryohalolentis MsbA presents unique challenges that require methodological rigor. Researchers should employ the following strategies to effectively synthesize information across experimental platforms:

Data normalization protocols:
Different experimental techniques generate data in varied formats and scales. To facilitate comparison:

  • Establish common reference points across experiments (e.g., activity of wild-type protein at 15°C as 100%)

  • Apply Z-score transformations to normalize data distributions from different techniques

  • Develop temperature correction factors when integrating data collected at different temperatures

  • Use dimensionless parameters when possible to facilitate cross-technique comparisons

Multi-modal data integration frameworks:

  • Bayesian network analysis can incorporate uncertainties from different experimental approaches and provide probabilistic models of structure-function relationships

  • Factor analysis can identify latent variables that explain correlated observations across multiple experimental platforms

  • Hierarchical clustering based on multiple data types can reveal patterns not apparent in single-technique analyses

Comparative visualization techniques:

  • Radar plots can effectively display multidimensional data comparisons across experimental platforms

  • Heat maps with hierarchical clustering can reveal patterns across multiple experimental conditions and protein variants

  • Network visualizations can map relationships between structural features and functional parameters

Resolving contradictions between techniques:
When different experimental approaches yield contradictory results, researchers should:

  • Evaluate the strengths and limitations of each methodology

  • Consider whether techniques are measuring different aspects of the same phenomenon

  • Develop testable hypotheses to explain divergent results

  • Design critical experiments specifically aimed at resolving contradictions

Systematic documentation standards:
To facilitate integration, researchers should maintain comprehensive documentation including:

  • Raw data accessibility in standardized formats

  • Detailed experimental conditions (particularly temperature, pH, and ionic strength)

  • Protein preparation characteristics (purity, oligomeric state, lipid content)

  • Explicit description of data processing algorithms and parameters

Collaborative validation approach:
Establish multi-laboratory validation protocols where key findings are independently verified using complementary techniques. This approach is particularly valuable for psychrophilic membrane proteins like P. cryohalolentis MsbA, where technical challenges in working with these proteins can introduce laboratory-specific artifacts.

By implementing these strategies, researchers can construct a more comprehensive and accurate understanding of P. cryohalolentis MsbA function that leverages the strengths of diverse experimental approaches while minimizing their individual limitations.

What are the most promising approaches for studying the role of P. cryohalolentis MsbA in extreme environment adaptation?

Several innovative approaches show particular promise for elucidating P. cryohalolentis MsbA's role in extreme environment adaptation:

Comparative cryomicrobiology:
Systematic comparison of MsbA function across bacteria inhabiting different thermal niches (psychrophiles, mesophiles, and thermophiles) can identify temperature-specific adaptations. This approach should include:

  • Reciprocal heterologous expression studies replacing native MsbA with variants from different temperature niches

  • Competition experiments under fluctuating temperature conditions to assess fitness contributions

  • Lipidomic analysis correlating membrane composition changes with MsbA function across temperature ranges

Advanced biophysical approaches:

  • Single-molecule FRET studies at different temperatures can track conformational dynamics of P. cryohalolentis MsbA during the transport cycle

  • High-pressure NMR techniques can examine how pressure (a relevant parameter in deep permafrost) affects protein dynamics

  • Neutron scattering analyses can provide insights into hydration shell differences that may contribute to psychrophilic adaptation

Systems biology integration:

  • Transcriptomic profiling under different stress conditions can identify co-regulated genes that function alongside MsbA

  • Metabolomic studies can reveal how MsbA function impacts cellular metabolism under cold stress

  • Network analysis can position MsbA within broader stress response pathways in P. cryohalolentis

Evolutionary reconstruction approaches:

  • Ancestral sequence reconstruction can identify key mutations that emerged during adaptation to cold environments

  • Directed evolution experiments applying cold selection pressure to mesophilic MsbA can reveal convergent adaptive pathways

  • Comparative genomics across psychrophiles can identify conserved features in MsbA and related transporters

Synthetic biology applications:

  • Chimeric proteins combining domains from psychrophilic and mesophilic MsbA can pinpoint regions critical for cold adaptation

  • CRISPR-mediated genome editing in P. cryohalolentis can create targeted mutations to test structure-function hypotheses

  • Engineering cold-adapted features from P. cryohalolentis MsbA into biotechnologically relevant transporters can create tools for low-temperature bioproduction systems

Mathematical modeling integration:

  • Development of multiscale models that connect molecular dynamics simulations of MsbA to cellular membrane properties and ultimately to population-level cold adaptation

  • Parameter sensitivity analysis can identify which features of MsbA contribute most significantly to cold tolerance

These approaches, particularly when integrated in complementary research programs, offer the most promising path toward understanding how P. cryohalolentis MsbA contributes to extreme environment adaptation, with potential applications in biotechnology, biomedicine, and astrobiology.

What implications does research on P. cryohalolentis MsbA have for developing novel antimicrobial strategies?

Research on P. cryohalolentis MsbA offers several promising avenues for antimicrobial development, with distinct advantages compared to conventional approaches:

Cold-active inhibitor development:
The unique structural features of psychrophilic MsbA provide templates for designing inhibitors effective at lower temperatures. This approach has significant implications for:

  • Treating infections in refrigerated food products where mesophilic-targeted antimicrobials show reduced efficacy

  • Developing topical antimicrobials for conditions where skin temperature is below normal (extremities in diabetic patients, hypothermic conditions)

  • Creating environmental decontamination agents effective in cold climates

Dual-target inhibitor design:
The finding that P. cryohalolentis MsbA utilizes both ATP hydrolysis and proton gradients suggests the potential for dual-mechanism inhibitors that:

  • Simultaneously target both energy coupling mechanisms

  • Exhibit synergistic effects by disrupting complementary energy sources

  • Present higher barriers to resistance development due to the need for multiple compensatory mutations

Immunomodulatory applications:
The observed moderate TLR4-mediated inflammatory response to P. cryohalolentis hypoacylated LPS suggests potential for:

  • Developing TLR4 antagonists based on modified lipid A structures

  • Creating anti-inflammatory compounds that modulate rather than block immune responses

  • Designing adjuvants with tunable immunostimulatory properties for vaccine development

Resistance mechanism insights:
Comparative studies between P. cryohalolentis and pathogenic bacteria MsbA can reveal:

  • Common vulnerability points across diverse bacterial species

  • Novel combination therapy approaches targeting multiple aspects of LPS biosynthesis and transport

  • Predictive models for resistance development pathways

Biofilm prevention strategies:
P. cryohalolentis MsbA's role in maintaining membrane integrity at low temperatures provides insights for:

  • Developing anti-biofilm agents effective in cold environments (medical devices, food processing equipment)

  • Creating surface coatings that specifically disrupt membrane transport functions critical for initial biofilm formation

Biotechnological applications:

  • Engineering cold-active drug efflux systems based on P. cryohalolentis MsbA for bioremediation in cold environments

  • Developing biosensors incorporating psychrophilic MsbA variants for detecting specific compounds at low temperatures

  • Creating expression systems for the production of membrane proteins at reduced temperatures to improve folding and stability

By exploring these diverse applications, research on P. cryohalolentis MsbA contributes not only to fundamental understanding of bacterial adaptation but also to practical antimicrobial strategies with potential advantages over conventional approaches, particularly for addressing infections in non-standard environmental conditions.

How might understanding P. cryohalolentis MsbA transport mechanisms inform research on human ABC transporters involved in multidrug resistance?

The study of P. cryohalolentis MsbA provides valuable insights that can inform research on human ABC transporters involved in multidrug resistance, particularly through evolutionary, mechanistic, and structural perspectives:

Evolutionary insights for drug design:
P. cryohalolentis MsbA represents an evolutionary distinct branch of ABC transporters that nonetheless maintains core functional mechanisms. This evolutionary distance can reveal:

  • Essential conserved features that persist across billions of years of separate evolution

  • Differentiating features that could be exploited for selective targeting of human versus bacterial transporters

  • Natural variations in substrate binding pockets that suggest unexplored chemical spaces for inhibitor design

Energy coupling mechanisms:
The discovery that P. cryohalolentis MsbA utilizes both ATP and proton gradients raises important questions about human ABC transporters :

  • Could some human ABC transporters also utilize secondary energy sources that have been overlooked?

  • Might cancer cells' altered membrane potentials affect ABC transporter function in ways not previously considered?

  • Could therapies targeting cellular energetics synergize with direct ABC transporter inhibitors?

Structural flexibility insights:
The cold-adaptation of P. cryohalolentis MsbA requires specific structural flexibility characteristics that:

  • Provide models for understanding conformational dynamics in human transporters

  • Suggest strategies for designing inhibitors that target specific conformational states

  • Offer insights into how membrane environmental factors influence transporter flexibility

Lipid interactions and regulation:
P. cryohalolentis MsbA functions in a distinct membrane environment with different lipid composition:

  • Comparative studies can reveal how lipid-protein interactions modulate transport activity

  • Insights into lipid regulation of bacterial transporters may translate to understanding how altered lipid profiles in cancer cells affect drug resistance

  • Potential for developing lipid-based modulators of human ABC transporters

Methodological advances:
Techniques developed to study the challenging P. cryohalolentis MsbA can be applied to human transporters:

  • Improved purification and reconstitution methods for unstable membrane proteins

  • Novel activity assays that distinguish between different energy coupling mechanisms

  • Advanced structural biology approaches optimized for flexible membrane proteins

Translational research opportunities:

  • Chimeric constructs combining domains from bacterial and human transporters can elucidate functional conservation

  • Heterologous expression systems using psychrophilic chassis organisms may improve expression of difficult human membrane proteins

  • Drug screening platforms incorporating psychrophilic transport assays may identify novel chemical scaffolds with activity against human transporters

By examining an evolutionarily distant but mechanistically related ABC transporter from an extreme environment, researchers gain fresh perspectives on fundamental principles governing this important protein family, potentially leading to novel approaches for addressing multidrug resistance in human disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.