Recombinant Psychrobacter cryohalolentis Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Description

Overview of the Compound

The recombinant Psychrobacter cryohalolentis Na⁺-translocating NADH-quinone reductase subunit E (nqrE) is a bacterial protein component of the Na⁺-translocating NADH-quinone oxidoreductase (NQR) complex. This enzyme complex is critical for bacterial respiration, coupling electron transfer from NADH to quinones with Na⁺ ion translocation across the membrane .

Key Features:

  • Protein Length: 202 amino acids (full-length) .

  • Expression System: Expressed in Escherichia coli .

  • Tag: His-tag (determined during production) .

  • Storage: Tris-based buffer (50% glycerol), stored at -20°C .

  • EC Number: 1.6.5.- (assigned to NADH dehydrogenases) .

Recombinant Production and Biotechnological Applications

The recombinant nqrE is commercially available for research purposes, with production optimized for structural and functional studies:

Production Parameters:

  • Expression Host: E. coli .

  • Purification: Nickel affinity chromatography (His-tag) .

  • Buffer Composition: Tris-based, pH 8.0 (with 50% glycerol for storage) .

Applications:

  • Enzymatic Assays: Studying Na⁺-translocation mechanisms or quinone reduction kinetics .

  • Immunological Studies: ELISA-based detection of nqrE in bacterial lysates or environmental samples .

Role in the NQR Complex

The NQR complex facilitates electron transport and Na⁺ pumping. Subunit E (nqrE) likely interacts with quinones or stabilizes the complex’s quinone-binding site.

Cold Adaptation

Psychrobacter cryohalolentis is a psychrophile isolated from Siberian permafrost . Though not directly studied for nqrE, its cold-adapted enzymes (e.g., catalase ) suggest potential structural flexibility or reduced hydrophobicity in nqrE, enabling function at low temperatures.

Comparative Analysis with Homologous Proteins

Recombinant nqrE from other psychrophilic or marine bacteria share similarities in production and structure:

SpeciesLength (aa)TagExpression HostKey Application
Psychrobacter cryohalolentis 202HisE. coliNQR complex studies, ELISA
Pseudoalteromonas atlantica 202HisE. coliQuinone reductase assays
Colwellia psychrerythraea 207HisE. coliBiochemical characterization

Key Differences:

  • Sequence Conservation: High similarity in active-site residues (e.g., motifs for quinone binding) .

  • Thermostability: Psychrobacter cryohalolentis nqrE likely retains activity at lower temperatures compared to mesophilic homologs .

Challenges and Future Directions

  • Limited Functional Data: No high-resolution structural studies or kinetic analyses of Psychrobacter cryohalolentis nqrE are currently available .

  • Potential Applications:

    • Bioremediation: Leveraging Na⁺-translocation for bioelectrochemical systems.

    • Drug Discovery: Targeting NQR complexes in pathogens .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
nqrE; Pcryo_2428; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Psychrobacter cryohalolentis (strain K5)
Target Names
nqrE
Target Protein Sequence
MGHYVSLFITSVFIENMALAYFLGMCTFLAVSKKVSTAIGLGVAVVVVMAITVPLNNLLF QFILKDGALAWAGFPDIDLSFLGLLSYIGLIAATVQILEMFLDKFVPSLYNALGVFLPLI TVNCAILGGVLFMVERDYNFGESVVYGVGAGFGWALAITALAGIREKLKYSDIPAPLRGL GITFITVGLMSLGFMSFGGMSI
Uniprot No.

Target Background

Function

The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol via two sequential reactions, coupled with the translocation of Na+ ions from the cytoplasm to the periplasm. NqrA through NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.

Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Psychrobacter cryohalolentis and why is it significant for Na+-NQR research?

Psychrobacter cryohalolentis is a Gram-negative, non-motile, non-pigmented, oxidase-positive coccobacillus belonging to the Gammaproteobacteria class. This psychrophilic bacterium was originally isolated from Siberian permafrost and has remarkable growth capabilities at temperatures ranging from -10°C to 30°C and can tolerate salinities from 0 to 1.7 M NaCl . The significance of P. cryohalolentis lies in its adaptation to extreme cold environments, making its Na+-NQR complex particularly interesting for understanding how these energy-transducing systems function under low-temperature conditions. The bacterium's optimal growth temperature is 10-15°C, classifying it as a true psychrophile, which provides unique opportunities to study cold-adapted versions of the Na+-NQR complex .

What is the basic function of Na(+)-translocating NADH-quinone reductase in bacterial systems?

Na(+)-translocating NADH:quinone oxidoreductase (Na+-NQR) serves as the initial enzyme complex in many bacterial respiratory chains, particularly in halophilic and marine bacteria. Its fundamental function is coupling NADH oxidation to ubiquinone reduction while simultaneously translocating sodium ions across the cytoplasmic membrane, thereby generating an electrochemical sodium gradient. Unlike the proton-pumping Complex I found in mitochondria and many bacteria, Na+-NQR utilizes sodium ions as the coupling ion. In bacterial systems such as V. cholerae, the Na+-NQR complex typically translocates two Na+ ions for each NADH molecule oxidized . This electrochemical gradient drives various cellular processes including ATP synthesis, nutrient transport, and flagellar rotation, making Na+-NQR essential for bacterial energy metabolism, particularly in sodium-rich environments.

What are the optimal conditions for expressing and studying recombinant P. cryohalolentis proteins?

For successful expression and study of recombinant P. cryohalolentis proteins, including nqrE, researchers should consider the following optimal conditions:

ParameterOptimal ConditionNotes
Growth temperature10-15°CP. cryohalolentis exhibits optimal growth at these psychrophilic temperatures
MediumMarine agar/broth with 2% NaClSupports robust growth of the organism
pH7.0-7.5Neutral pH range is suitable for most Psychrobacter species
Expression systemE. coli Arctic Express or similar cold-adapted systemsStandard E. coli systems may be used but with reduced cultivation temperature
Induction conditionsLow IPTG (0.1-0.3 mM) at 15°C for 24-48 hoursSlow induction favors proper folding of psychrophilic proteins
Buffer systemsTris-HCl or phosphate buffers with 5-10% glycerolAddition of stabilizing agents helps maintain protein integrity

When expressing membrane proteins like nqrE, detergent selection becomes critical, with milder detergents such as DDM (n-dodecyl β-D-maltoside) often yielding better results for cold-adapted membrane proteins. For studying Na+-NQR activity, the inclusion of sodium ions (typically 100-200 mM NaCl) in the reaction buffers is essential to observe physiologically relevant activity .

What are the key structural differences between Na+-NQR from psychrophilic bacteria compared to mesophilic counterparts?

The Na+-NQR complex from psychrophilic bacteria like P. cryohalolentis exhibits several structural adaptations that distinguish it from mesophilic counterparts such as the V. cholerae enzyme. These cold-adapted structural features include:

  • Increased flexibility in regions surrounding catalytic sites, achieved through a reduction in proline residues and an increase in glycine content, which facilitates catalysis at low temperatures.

  • Reduced hydrophobic core stability due to fewer aromatic interactions and decreased arginine content, creating a more "loose" structure that maintains conformational mobility at low temperatures.

  • Increased surface hydrophilicity through a higher proportion of charged residues (particularly acidic amino acids) on the protein surface, which enhances solvent interactions and prevents cold denaturation.

  • Modified cofactor binding sites that may exhibit lower binding affinity but faster exchange rates, contributing to maintained catalytic activity at reduced temperatures.

In the specific case of the nqrE subunit, these adaptations likely focus on the transmembrane helices that must maintain appropriate flexibility for ion translocation even at temperatures as low as -10°C. Structural studies using cryo-EM would be particularly valuable for identifying the precise molecular differences in the P. cryohalolentis Na+-NQR complex compared to the V. cholerae structure, which shows conformational changes coupling electron transfer to sodium translocation .

How can transposon mutagenesis be optimized for functional studies of the nqrE gene in P. cryohalolentis?

Transposon mutagenesis can be effectively optimized for functional studies of nqrE in P. cryohalolentis by adapting the tri-parental conjugation method described for this organism. Based on previous successful approaches with P. cryohalolentis, the following optimized protocol is recommended:

  • Utilize a tri-parental conjugation system with:

    • E. coli donor strain (S17-1) carrying a plasmid with a mini-Tn5 transposon containing kanamycin resistance

    • E. coli helper strain carrying pRK2013

    • P. cryohalolentis PAMC 21807 as the recipient

  • Optimize selection conditions:

    • Marine agar 2216 supplemented with 2% NaCl

    • 50 μg·mL⁻¹ kanamycin for selection of transformants

    • Incubation at 15°C, which allows P. cryohalolentis growth while limiting E. coli growth

  • Verify recombinants through:

    • PCR screening for the kanamycin resistance gene (nptII)

    • RFLP analysis of 16S rDNA to confirm species identity

    • Southern hybridization to confirm genomic integration rather than episomal presence

  • For nqrE-specific studies:

    • Design transposons with reporter genes to monitor nqrE expression

    • Use site-directed transposon insertion targeting the nqrE locus

    • Create a complementation system using a low-copy plasmid expressing wild-type nqrE

While this approach has shown relatively low efficiency in P. cryohalolentis (approximately 7.7% genomic integration rate based on previous studies), increasing the scale of the conjugation reaction and implementing counterselection against E. coli can improve success rates .

What experimental approaches can distinguish Na+ transport mechanisms in recombinant nqrE versus the complete Na+-NQR complex?

Distinguishing Na+ transport mechanisms in isolated recombinant nqrE versus the complete Na+-NQR complex requires sophisticated biophysical and biochemical approaches:

  • Reconstitution studies:

    • Purified recombinant nqrE can be reconstituted into liposomes loaded with sodium-sensitive fluorescent dyes (e.g., SBFI)

    • Parallel reconstitution of complete Na+-NQR complex

    • Comparison of Na+ transport kinetics in both systems upon addition of electron donors

  • Electrophysiological measurements:

    • Incorporation of nqrE or complete Na+-NQR into planar lipid bilayers

    • Patch-clamp analysis to measure ion conductance

    • This approach can determine if nqrE alone forms a functional Na+ channel or requires other subunits

  • Site-directed mutagenesis combined with functional assays:

    • Mutation of conserved residues in nqrE predicted to be involved in Na+ binding/translocation

    • Complementary mutations in other subunits (particularly NqrB, which contains a known Na+ binding site )

    • Analysis of how mutations affect Na+ translocation in the isolated subunit versus the complete complex

  • Crosslinking and structural studies:

    • Chemical crosslinking to identify residues in nqrE that interact with Na+ or with other subunits during transport

    • Cryo-EM analysis of nqrE alone and within the complex in different conformational states

  • Computational approaches:

    • Molecular dynamics simulations of ion movement through nqrE and the complete complex

    • Identification of potential Na+ binding sites and energy barriers

These complementary approaches can reveal whether nqrE functions as an independent Na+ transporter or if it requires the coordinated action of other subunits, particularly in the context of the redox-driven conformational changes observed in Na+-NQR complexes .

How does the ion specificity of P. cryohalolentis Na+-NQR compare with other bacterial species, and what role does nqrE play in this specificity?

The ion specificity of Na+-NQR varies among bacterial species, with important implications for nqrE function:

  • Ion selectivity profile:

    • Most Na+-NQR complexes, including those from Vibrio species, exhibit high selectivity for Na+ over other monovalent cations

    • P. cryohalolentis Na+-NQR likely maintains Na+ selectivity, but may show altered affinity due to cold adaptation

    • Comparative studies should examine whether Li+ can substitute for Na+ in the psychrophilic enzyme, as observed in some mesophilic Na+-NQR complexes

  • Role of nqrE in ion selectivity:

    • While subunit NqrB contains a well-characterized Na+ binding site in V. cholerae Na+-NQR , nqrE likely contributes to forming the complete ion translocation pathway

    • The transmembrane helices of nqrE may form part of the ion channel or may undergo conformational changes that regulate ion access to binding sites

    • Sequence analysis of P. cryohalolentis nqrE reveals certain conserved polar and charged residues within transmembrane segments that may contribute to ion coordination

  • Cold adaptation effects on ion selectivity:

    • At low temperatures, the hydration energy of ions increases, potentially affecting ion selectivity

    • P. cryohalolentis Na+-NQR may have evolved structural adaptations in nqrE and other subunits to maintain appropriate Na+ selectivity despite these thermodynamic challenges

    • The kinetics of ion binding and release are likely optimized for function at low temperatures

  • Experimental determination:

    • Ion competition assays with purified recombinant enzyme

    • Measurement of enzyme activity in the presence of various cations (Na+, Li+, K+, NH4+)

    • Isothermal titration calorimetry to determine binding affinities for different ions

Understanding the ion specificity of P. cryohalolentis Na+-NQR and the contribution of nqrE to this property has implications for both basic understanding of cold adaptation and potential biotechnological applications in low-temperature bioenergetics.

What expression systems are most effective for producing functional recombinant P. cryohalolentis nqrE?

Expressing functional membrane proteins from psychrophilic organisms presents unique challenges that require specialized expression systems:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli Arctic ExpressContains cold-adapted chaperonins (Cpn10/Cpn60) from Oleispira antarctica; Supports growth at 4-12°CLimited membrane protein machineryUse with C41/C43(DE3) strains specialized for membrane proteins; Include pRARE plasmid for rare codon supplementation
E. coli LEMO21(DE3)Tunable expression via rhamnose-controlled lysozyme; Reduces toxicity of membrane proteinsNot specifically adapted for cold-temperature expressionCulture at reduced temperatures (15-20°C); Extended, slow induction at low IPTG concentrations
P. cryohalolentis expression systemNative cellular machinery for proper folding and insertion; Native lipid environmentLimited genetic tools; Lower yields than E. coliDevelop based on successful transposon mutagenesis methods ; Use strong native promoters
Cell-free expressionCircumvents toxicity issues; Direct incorporation into nanodiscs/liposomesExpensive; Complex setup for membrane proteinsSupplement with P. cryohalolentis lipid extracts; Perform reactions at 10-15°C

For optimal results with recombinant P. cryohalolentis nqrE:

  • Modify the gene sequence to optimize codon usage while maintaining critical structural features

  • Include a cleavable N-terminal fusion partner (such as MBP) to enhance solubility

  • Co-express with chaperone proteins, especially those from psychrophilic organisms

  • Use mild non-ionic detergents (DDM, LMNG) for extraction and purification

  • Consider expression as part of a multi-subunit construct containing at least NqrB and NqrE to stabilize the protein

Following expression, confirm proper folding using circular dichroism spectroscopy and verify membrane integration using sucrose gradient ultracentrifugation .

What are the recommended protocols for measuring Na+ translocation activity in recombinant Na+-NQR containing nqrE?

Measuring Na+ translocation activity in recombinant Na+-NQR requires specialized techniques that can detect ion movement across membranes:

  • Reconstitution-based assays:

    • Reconstitute purified Na+-NQR complex into proteoliposomes

    • Load vesicles with the sodium-sensitive fluorophore SBFI

    • Initiate reaction with NADH addition and monitor fluorescence changes

    • Calculate Na+ transport rates based on fluorescence calibration curves

  • 22Na+ radioisotope flux measurements:

    • Prepare proteoliposomes containing Na+-NQR

    • Initiate Na+ uptake with NADH addition in the presence of 22Na+

    • Terminate reaction at different time points by rapid filtration

    • Quantify incorporated radioactivity by scintillation counting

  • pH/sodium electrode-based measurements:

    • Dual-electrode setup to simultaneously monitor pH and Na+ concentration changes

    • Add NADH to purified enzyme preparation in a weakly buffered solution

    • Record electrode outputs to measure stoichiometry of H+ consumption vs Na+ extrusion

  • Fluorescence quenching assays:

    • Use quinacrine as a ΔpH indicator or oxonol V as a membrane potential indicator

    • Monitor fluorescence changes upon NADH addition to Na+-NQR proteoliposomes

    • Perform parallel experiments with specific inhibitors to confirm specificity

Optimal reaction conditions for P. cryohalolentis Na+-NQR activity measurements:

  • Temperature: 10-15°C (physiologically relevant) and 25°C (for comparison with mesophilic enzymes)

  • Buffer: 50 mM HEPES or Tris, pH 7.5

  • Salts: 100-200 mM NaCl or variable Na+ for kinetic studies

  • Substrates: 100 μM NADH, 50 μM ubiquinone (or appropriate quinone for P. cryohalolentis)

  • Controls: Include samples with the Na+ ionophore monensin to dissipate Na+ gradients

These methods allow for quantitative assessment of Na+ translocation activity and can be applied to comparative studies between wild-type and mutant forms of nqrE to determine the contribution of specific residues to the ion transport mechanism .

What analytical techniques are most useful for studying conformational changes in nqrE during the catalytic cycle?

Understanding the conformational changes in nqrE during catalytic cycling requires advanced biophysical techniques:

  • Time-resolved spectroscopic methods:

    • Transient absorption spectroscopy to monitor cofactor redox changes

    • Time-correlated single photon counting (TCSPC) for fluorescence lifetime measurements of labeled nqrE

    • These techniques can detect conformational changes with microsecond to millisecond resolution

  • Site-directed spin labeling (SDSL) combined with electron paramagnetic resonance (EPR):

    • Introduction of cysteine residues at strategic positions in nqrE for spin label attachment

    • Continuous wave or pulsed EPR measurements to monitor distance changes between labels

    • Double electron-electron resonance (DEER) spectroscopy for precise distance measurements (1-8 nm range)

    • This approach can generate distance constraint data during different stages of the catalytic cycle

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Exposure of nqrE to D2O under various redox conditions

    • Quantification of hydrogen-deuterium exchange rates by mass spectrometry

    • Identification of regions with altered solvent accessibility during the catalytic cycle

    • This technique provides peptide-level resolution of dynamic structural changes

  • Single-molecule Förster resonance energy transfer (smFRET):

    • Attachment of donor-acceptor fluorophore pairs to specific sites in nqrE

    • Observation of FRET efficiency changes at the single-molecule level

    • Direct visualization of conformational state distributions and transitions

  • Cryo-electron microscopy (cryo-EM) of reaction intermediates:

    • Rapid freezing of Na+-NQR complex at defined stages of the catalytic cycle

    • 3D reconstruction of different conformational states

    • This approach can potentially capture distinct structural states, similar to those observed in V. cholerae Na+-NQR

For P. cryohalolentis nqrE, these techniques should be optimized for low-temperature conditions to capture physiologically relevant conformational dynamics. The comparison between conformational changes at low (4-15°C) versus moderate (25-30°C) temperatures may reveal important insights into the cold adaptation of this ion-translocating machinery.

How can researchers overcome challenges in crystallizing membrane proteins like nqrE for structural studies?

Crystallization of membrane proteins like nqrE presents significant challenges due to their hydrophobicity and conformational flexibility. Researchers can employ the following strategies to improve success rates:

  • Protein engineering approaches:

    • Truncation of disordered regions identified through disorder prediction algorithms

    • Creation of fusion constructs with crystallization chaperones (e.g., T4 lysozyme, BRIL)

    • Introduction of surface mutations to enhance crystal contacts while preserving function

    • Co-expression with stabilizing binding partners (e.g., antibody fragments, nanobodies)

  • Advanced detergent and lipid strategies:

    • Systematic screening of conventional and novel detergents (MNG, GDN)

    • Lipidic cubic phase (LCP) crystallization, which provides a more native-like environment

    • Bicelle crystallization combining lipids and detergents

    • Nanodiscs or amphipols for enhanced stability during purification

  • Crystallization condition optimization:

    • High-throughput sparse matrix screening at multiple temperatures (4-20°C)

    • Inclusion of specific lipids identified in the native membrane

    • Addition of stabilizing ligands or substrate analogs

    • Controlled dehydration of initial crystals to improve diffraction quality

  • Alternative structural approaches:

    • Cryo-EM single-particle analysis, which has revolutionized membrane protein structural biology

    • Electron crystallography of 2D crystals

    • X-ray free electron laser (XFEL) diffraction of microcrystals

For P. cryohalolentis nqrE specifically:

  • Perform purification and crystallization trials at reduced temperatures (10-15°C)

  • Include cryoprotectants during all steps to stabilize the psychrophilic protein

  • Consider co-crystallization with other Na+-NQR subunits, particularly NqrB

  • Use statistical coupling analysis to identify co-evolving residues that could be mutated to enhance stability

Table: Successful membrane protein crystallization methods applied to respiratory chain components:

MethodExample SuccessPotential Application to nqrE
LCP crystallizationBacterial rhodopsins, GPCRsSuitable for highly hydrophobic regions of nqrE
Antibody fragment co-crystallizationCytochrome c oxidaseCan stabilize flexible loops between transmembrane helices
Fusion protein strategyβ2-adrenergic receptor-T4LMay stabilize nqrE N- or C-terminal domains
Cryo-EMRespiratory complex ILikely most promising for complete Na+-NQR complex

The recent success with cryo-EM studies of V. cholerae Na+-NQR suggests this approach may be particularly valuable for structural studies of P. cryohalolentis nqrE, especially when examining the complete complex.

How can researchers address protein stability issues when working with psychrophilic nqrE at laboratory temperatures?

Working with psychrophilic proteins like P. cryohalolentis nqrE at typical laboratory temperatures presents significant stability challenges. Researchers can implement several strategies to maintain protein integrity:

  • Temperature management throughout the research pipeline:

    • Perform all purification steps in cold rooms (4°C) or using ice baths

    • Develop specialized equipment for conducting experiments at 0-15°C

    • Consider using temperature-controlled microfluidic devices for rapid analyses

    • Monitor protein stability at different temperatures using differential scanning fluorimetry

  • Buffer optimization strategies:

    • Incorporate osmolytes and cryoprotectants (glycerol 10-20%, trehalose, sucrose)

    • Add stabilizing agents specific for membrane proteins (cholesterol hemisuccinate, specific lipids)

    • Optimize ionic strength based on stability screening (typically higher salt concentrations)

    • Include reducing agents to prevent oxidative damage (DTT, TCEP)

  • Protein engineering approaches:

    • Introduce stabilizing mutations based on comparison with mesophilic homologs

    • Create chimeric proteins incorporating stabilizing domains from mesophilic Na+-NQR

    • Use computational design to identify stabilizing mutations that preserve function

    • Consider directed evolution approaches to select for more stable variants

  • Storage and handling protocols:

    • Flash-freeze aliquots in liquid nitrogen immediately after purification

    • Store samples at -80°C with cryoprotectants

    • Minimize freeze-thaw cycles by preparing single-use aliquots

    • Consider lyophilization with appropriate excipients for long-term storage

  • Rapid analysis workflows:

    • Develop streamlined protocols that minimize time at destabilizing temperatures

    • Implement automation where possible to reduce handling time

    • Consider on-column or in situ analyses that can be performed immediately after purification

When analyzing stability data, researchers should generate temperature-activity profiles comparing P. cryohalolentis nqrE with mesophilic homologs to quantify the extent of cold adaptation and identify critical temperature thresholds for experimental design .

What are the most common pitfalls in functional studies of Na+-NQR and how can they be avoided?

Functional studies of Na+-NQR complex and its subunits present several common pitfalls that researchers should anticipate and address:

  • Distinguishing Na+-NQR activity from other NADH dehydrogenases:

    • Pitfall: Contaminating NADH dehydrogenase activities can confound results

    • Solution: Use specific inhibitors (e.g., HQNO, korormicin) that selectively inhibit Na+-NQR

    • Validation: Compare activities in the presence and absence of Na+ to identify Na+-dependent components

  • Maintaining native lipid environment:

    • Pitfall: Detergent solubilization can disrupt essential lipid-protein interactions

    • Solution: Supplement purified protein with lipids from the native organism

    • Alternative approach: Use nanodisc or amphipol reconstitution to provide a more native-like environment

  • Cofactor loss during purification:

    • Pitfall: Na+-NQR contains multiple cofactors that can dissociate during purification

    • Solution: Supplement buffers with flavins (FAD, FMN, riboflavin) during purification

    • Verification: Measure flavin content spectroscopically before functional assays

  • Oxidative damage to iron-sulfur clusters:

    • Pitfall: [2Fe-2S] clusters in Na+-NQR are sensitive to oxidation

    • Solution: Maintain strict anaerobic conditions during critical steps

    • Implementation: Use glove boxes or sealed cuvettes with glucose oxidase/catalase oxygen scavenging systems

  • Temperature-dependent artifact in psychrophilic enzymes:

    • Pitfall: Activity measurements at non-physiological temperatures can yield misleading results

    • Solution: Perform parallel assays at multiple temperatures (4°C, 15°C, 25°C)

    • Analysis: Create Arrhenius plots to understand temperature dependence of activity

  • Na+ contamination skewing ion specificity studies:

    • Pitfall: Trace Na+ contamination in buffers can confound ion specificity experiments

    • Solution: Use highest purity reagents and plastic labware instead of glass

    • Control: Measure actual Na+ concentrations in prepared buffers using atomic absorption spectroscopy

  • Interpreting complex kinetic data:

    • Pitfall: Na+-NQR exhibits complex kinetics that can be misinterpreted

    • Solution: Apply appropriate enzyme kinetic models that account for multiple substrates and allosteric effects

    • Validation: Use global fitting approaches to simultaneously analyze data from multiple experiments

By anticipating these common pitfalls, researchers can design more robust experimental protocols for studying P. cryohalolentis nqrE and the complete Na+-NQR complex, leading to more reliable and reproducible results .

How can researchers reconcile conflicting data between in vitro studies of recombinant nqrE and whole-cell physiological experiments?

Reconciling discrepancies between in vitro biochemical studies and whole-cell physiological experiments is a common challenge in Na+-NQR research. A systematic approach to addressing these conflicts includes:

By systematically addressing discrepancies between different experimental systems, researchers can develop a more complete and accurate understanding of nqrE function within the Na+-NQR complex of P. cryohalolentis .

What are promising applications of psychrophilic Na+-NQR research in biotechnology and bioenergetics?

Research on psychrophilic Na+-NQR from P. cryohalolentis offers several promising applications in biotechnology and bioenergetics:

  • Cold-active bioenergetic systems:

    • Development of microbial fuel cells operating at low temperatures (4-15°C)

    • Application in cold environments where mesophilic systems would be inefficient

    • Potential uses in Nordic/Arctic regions, deep-sea applications, or winter outdoor deployments

    • Coupling with psychrophilic photosynthetic systems for solar-powered bioenergetics in cold climates

  • Protein engineering platforms:

    • Using insights from psychrophilic Na+-NQR to engineer cold-tolerance into other membrane proteins

    • Creating chimeric energy-transducing complexes with enhanced temperature range

    • Developing a modular approach to cold-adaptation of industrial enzymes

    • Understanding the molecular basis of temperature adaptation in membrane proteins

  • Bioremediation technologies:

    • Engineering cold-adapted microorganisms with enhanced Na+-NQR for bioremediation in cold environments

    • Developing pollution sensors based on Na+-NQR activity that function in cold conditions

    • Creating bioreactors for wastewater treatment in cold climates with improved energy efficiency

  • Biomimetic energy conversion:

    • Designing synthetic ion pumps based on Na+-NQR principles for nanoscale energy conversion

    • Creating artificial membranes with incorporated Na+-NQR for energy generation

    • Developing hybrid systems combining biological ion pumps with artificial electron transport chains

  • Pharmaceutical applications:

    • Na+-NQR as a target for developing antibiotics specific to psychrophilic pathogens

    • Structure-based drug design targeting unique features of psychrophilic Na+-NQR

    • Development of screening platforms for identifying inhibitors of bacterial Na+-NQR

The application of P. cryohalolentis Na+-NQR research in these fields depends on developing a comprehensive understanding of the structure-function relationships in this unique cold-adapted enzyme complex, with nqrE playing a crucial role in the ion translocation mechanism that underlies its bioenergetic function .

What emerging technologies show promise for elucidating the complete mechanism of Na+ translocation in psychrophilic Na+-NQR?

Several cutting-edge technologies are emerging as powerful tools for deciphering the complete Na+ translocation mechanism in psychrophilic Na+-NQR:

  • Integrative structural biology approaches:

    • Time-resolved cryo-EM to capture conformational changes during the catalytic cycle

    • Microcrystal electron diffraction (MicroED) for structural determination of challenging membrane proteins

    • Serial femtosecond crystallography using X-ray free electron lasers (XFELs) to obtain room-temperature structures without radiation damage

    • These methods could reveal the complete conformational cycle of Na+-NQR, building on the structural insights gained from V. cholerae Na+-NQR

  • Advanced spectroscopic techniques:

    • Two-dimensional infrared (2D-IR) spectroscopy to track protein dynamics at picosecond timescales

    • Electron paramagnetic resonance dipolar spectroscopy (PELDOR/DEER) with tailored spin labels for precise distance measurements

    • Ultrafast transient absorption spectroscopy to track electron transfer through the cofactor chain

    • These methods can provide detailed information about the dynamics of conformational changes and electron transfer events

  • Computational approaches:

    • Quantum mechanics/molecular mechanics (QM/MM) simulations to model electron transfer coupled to conformational changes

    • Machine learning approaches to integrate diverse experimental datasets

    • Long-timescale molecular dynamics simulations using specialized hardware

    • Enhanced sampling techniques to capture rare conformational transitions

    • These computational methods can model aspects of Na+-NQR function that are difficult to access experimentally

  • Single-molecule techniques:

    • High-speed atomic force microscopy (HS-AFM) to visualize conformational dynamics in real-time

    • Single-molecule FRET with multiple fluorophores to track complex conformational changes

    • Nanopore-based single-molecule electrophysiology to directly measure ion translocation events

    • These approaches can reveal heterogeneity in behavior that is masked in ensemble measurements

  • Genetic and genome editing tools:

    • CRISPR-Cas9 genome editing in P. cryohalolentis to create precise mutations

    • Unnatural amino acid incorporation to introduce probe groups at specific positions

    • In vivo crosslinking to capture transient protein-protein interactions

    • These molecular biology tools enable sophisticated manipulation of Na+-NQR in its native context

By integrating these emerging technologies, researchers can develop a comprehensive understanding of how electron transfer through the unique cofactor chain of Na+-NQR drives conformational changes in the enzyme complex, particularly involving nqrE, that ultimately result in the vectorial transport of Na+ ions across the membrane .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.