Recombinant Psychrobacter cryohalolentis NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Identification and Synonyms

Recombinant Psychrobacter cryohalolentis NADH-quinone oxidoreductase subunit A (nuoA) is a protein involved in oxidoreductase activity, acting on NADH or NADPH . Synonyms include NADH-quinone oxidoreductase subunit A, and the gene name is nuoA .

General Function

The general function of nuoA is its involvement in oxidoreductase activity, specifically acting on NADH or NADPH .

Specific Function

NDH-1, which includes the nuoA subunit, transfers electrons from NADH to quinones in the respiratory chain via FMN and iron-sulfur (Fe-S) centers . It is believed that ubiquinone is the immediate electron acceptor for this enzyme in this species . The enzyme couples the redox reaction to proton translocation, where four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, thus preserving the redox energy in a proton gradient .

Cellular Location

NuoA is located in the cell's inner membrane as a multi-pass membrane protein .

Blattner

The Blattner number for this gene is b2288 .

Gene Orientation

The gene orientation is counterclockwise .

Centisome Percentage

The centisome percentage is 51.78 .

Subunit Composition

The subunit composition of NADH:quinone oxidoreductase I includes :
[NuoA][NuoH][NuoJ][NuoK][NuoL][NuoM][NuoN][(NuoB)(NuoC)(NuoE)(NuoF)(NuoG)(NuoI)]

Role in Energy Metabolism

NADH:quinone oxidoreductases are crucial quinone reductases because they connect almost all catabolic pathways to respiratory chains .

Recombinant Production

Recombinant Full Length Psychrobacter cryohalolentis NADH-quinone oxidoreductase subunit A (nuoA) Protein (Q1QD97) (1-207aa), fused to N-terminal His tag, can be expressed in E. coli .

Tables

IdentificationDescription
NameNADH-quinone oxidoreductase subunit A
Synonyms
Gene NamenuoA
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity, acting on NADH or NADPH
Specific FunctionNDH-1 shuttles electrons from NADH, via FMN and iron- sulfur (Fe-S) centers, to quinones in the respiratory chain, couples the redox reaction to proton translocation
Cellular LocationCell inner membrane; Multi-pass membrane protein
Gene Properties
Blattnerb2288
Gene OrientationCounterclockwise
Centisome Percentage51.78

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; Pcryo_0573; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-207
Protein Length
full length protein
Species
Psychrobacter cryohalolentis (strain K5)
Target Names
nuoA
Target Protein Sequence
MSAFNLSAIAFILAAIGLVVFMLVVPRLLGGRSHGSQKEEIFEAGVVGSGNARIRLSAKF YLVAIFFVIFDLEALYLYAYAVSVREAGWLGFAAAAIFITILIIGLVYELSLGAMNWAPA DKLRKKARLYAAPAGFSLADITKFDGVDELMVDPTGKIPAQSSGQINVSNNIETNRRHLQ NIDHINTTGNVTSVDFATSAQTDKMTR
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation across the cytoplasmic membrane; for every two electrons transferred, four protons are translocated, thereby conserving redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Psychrobacter cryohalolentis and why is its Complex I significant?

Psychrobacter cryohalolentis K5T is a cold-adapted bacterium isolated from Siberian permafrost with remarkable capabilities for growth and survival at low temperatures . Its study holds particular relevance for understanding microbial adaptation to extreme environments, including deep sea, Antarctic and Arctic permafrost, and even potential extraterrestrial habitats such as Mars .

The NADH:quinone oxidoreductase (Complex I) in this organism represents a critical component of its respiratory chain, facilitating energy conservation under cold conditions. Unlike some organisms that lack this complex enzyme, P. cryohalolentis has retained this mechanism, suggesting its importance for the organism's energy metabolism in cold environments. The study of this complex provides insights into the molecular adaptations that enable life in extreme cold, with implications for understanding fundamental principles of bacterial bioenergetics and stress responses .

What is the genomic context of nuoA in P. cryohalolentis?

The nuoA gene in P. cryohalolentis exists within a gene cluster encoding the complete NADH:quinone oxidoreductase (Complex I). Based on patterns observed across bacterial species, the genes encoding Complex I (nuoA to nuoN) are colocalized in 86% of bacterial genomes where the enzyme is found, typically arranged as part of a polycistronic operon .

In P. cryohalolentis specifically, this genomic organization likely reflects the functional integration of the 14 subunits that comprise Complex I. The nuoA gene produces the NuoA protein, one of the membrane-embedded subunits involved in the proton translocation mechanism of Complex I. Genomic analysis reveals that P. cryohalolentis contains the complete set of genes required for Complex I function, indicating the importance of this respiratory enzyme for its survival, particularly in cold environments where energy conservation efficiency becomes crucial .

How does bacterial Complex I function differ from mitochondrial Complex I?

Bacterial Complex I and mitochondrial Complex I share the fundamental function of coupling NADH oxidation to proton translocation across a membrane, but several key differences exist:

FeatureBacterial Complex IMitochondrial Complex I
Subunit compositionTypically 14 subunits (NuoA-N)45 subunits in humans
Size~550 kDa~980 kDa
Gene organizationOften in a single operonEncoded by both nuclear and mitochondrial genomes
Iron-sulfur clustersVariable presence of N7 clusterMore conserved iron-sulfur cluster arrangement
Physiological roleVersatile (can operate in reverse in some bacteria)Primarily forward reaction (NADH oxidation)

In bacteria like P. cryohalolentis, Complex I exhibits greater functional versatility compared to its mitochondrial counterpart. In some bacteria, Complex I can catalyze the reverse reaction, using proton motive force to drive NADH synthesis from quinol, which serves to prevent overreduction of the quinone pool and provide cellular reducing equivalents . This reversibility may be particularly relevant for organisms adapting to fluctuating environmental conditions, such as the extreme cold faced by P. cryohalolentis .

What are the predicted structural features of P. cryohalolentis NuoA?

While no specific structural data for P. cryohalolentis NuoA is available in the provided search results, analysis of Complex I across bacterial clades provides insights into its likely characteristics. Based on phylogenomic studies, bacterial Complex I exhibits five main evolutionary clades (A-E) with distinctive structural features .

NuoA, as one of the membrane-embedded subunits of Complex I, plays a critical role in the proton translocation mechanism. In bacteria, NuoA typically contains three transmembrane helices that contribute to the membrane arm of Complex I. The specific amino acid composition of P. cryohalolentis NuoA likely contains cold-adaptive features such as:

  • Increased flexibility in loop regions

  • Modified hydrophobic core packing to maintain function at low temperatures

  • Potentially altered charged residue distribution at helix interfaces

Comparative structural analysis with other bacterial NuoA proteins would be necessary to identify the specific adaptations in P. cryohalolentis NuoA that contribute to its functionality in cold environments .

How might the cold adaptation of P. cryohalolentis affect NuoA function?

P. cryohalolentis, as a psychrophilic organism isolated from Siberian permafrost, has evolved numerous molecular adaptations to maintain enzymatic activity and membrane fluidity at low temperatures . These adaptations likely extend to its respiratory complexes, including NuoA:

  • Protein flexibility modifications: The NuoA protein likely contains increased glycine content and reduced proline content in loops connecting transmembrane helices, increasing flexibility at low temperatures.

  • Membrane interaction adaptations: NuoA's transmembrane domains may contain alterations in hydrophobic amino acid composition to maintain proper folding and interaction with the more fluid membrane structure typical of psychrophilic bacteria.

  • Energy coupling efficiency: The proton translocation mechanism involving NuoA may be optimized for efficiency at low temperatures, potentially with modified coupling ratios compared to mesophilic organisms.

  • Protein-protein interaction surfaces: The interfaces between NuoA and other Complex I subunits likely contain modifications to maintain proper assembly at low temperatures, potentially with more hydrogen bonding and fewer hydrophobic interactions.

These cold-adaptive features would necessitate specific experimental approaches when working with recombinant P. cryohalolentis NuoA, including temperature-sensitive purification protocols and activity assays conducted at temperatures relevant to its natural environment .

What are the predicted electron transfer properties of P. cryohalolentis Complex I?

While specific electron transfer properties of P. cryohalolentis Complex I are not detailed in the search results, comparative analysis with other bacterial Complex I systems provides insight. Complex I couples the transfer of electrons from NADH to quinone with the translocation of protons across the membrane . The electron transfer pathway involves:

  • NADH oxidation at the NuoEFG subunits

  • Electron transfer through a series of iron-sulfur clusters

  • Quinone reduction at the interface of the peripheral and membrane arms

  • Coupling of these redox reactions to proton translocation

The iron-sulfur cluster composition varies between different Complex I clades. Some bacterial Complex I enzymes contain a bacterium-specific iron-sulfur cluster N7, bound to a CXXCXXXC-(X)27-C motif . The presence or absence of this cluster in P. cryohalolentis would depend on which Complex I clade it belongs to.

Temperature adaptation likely affects the redox potentials and electron transfer kinetics in P. cryohalolentis Complex I. At low temperatures, the enzyme would need to maintain efficient electron tunneling rates between redox centers while operating in an environment with reduced thermal energy. This might involve optimized distances between electron carriers or modified protein environments around the redox centers to fine-tune their potentials .

What expression systems are recommended for recombinant P. cryohalolentis NuoA?

Several expression systems can be considered for the production of recombinant P. cryohalolentis NuoA, each with specific advantages and limitations:

Expression SystemAdvantagesLimitationsRecommendations
E. coliWell-established protocols, high yieldPotential folding issues with membrane proteinsUse C41(DE3) or C43(DE3) strains specialized for membrane proteins
Cold-adapted expression hostsBetter folding at low temperaturesLess developed genetic toolsConsider Pseudoalteromonas haloplanktis TAC125 for psychrophilic expression
Cell-free systemsAvoids toxicity issues, direct membrane incorporationLower yields, higher costUseful for initial structural studies

For optimal expression of P. cryohalolentis NuoA, we recommend a modified E. coli-based approach with the following protocol adjustments:

  • Clone the nuoA gene with its native ribosome binding site into a vector with an inducible promoter (pET or pBAD series)

  • Transform into E. coli C41(DE3) strain (designed for membrane protein expression)

  • Grow cultures at 18-20°C following induction

  • Supplement media with specific lipids to improve membrane protein folding

  • Consider co-expression with chaperones to enhance proper folding

The cold-adapted nature of P. cryohalolentis proteins makes low-temperature induction essential for proper folding of NuoA, even in mesophilic expression hosts .

What purification strategies are effective for recombinant P. cryohalolentis NuoA?

Purification of membrane proteins like NuoA presents significant challenges. For P. cryohalolentis NuoA, we recommend a comprehensive strategy that maintains protein stability while achieving high purity:

  • Membrane extraction:

    • Harvest cells and disrupt using French press or sonication at 4°C

    • Isolate membrane fraction through differential centrifugation

    • Solubilize membranes using mild detergents (DDM or LMNG at 1-2%)

  • Affinity purification:

    • Design construct with His6-tag or other affinity tag

    • Perform immobilized metal affinity chromatography at 4°C

    • Use detergent-containing buffers throughout purification

  • Additional purification steps:

    • Size exclusion chromatography for final purification and detergent exchange

    • Consider amphipol exchange for improved stability

  • Cold-adapted considerations:

    • Maintain all purification steps at 4°C or lower

    • Include glycerol (10-20%) in all buffers to prevent freezing at sub-zero temperatures

    • Test stability at temperatures relevant to P. cryohalolentis native environment

  • Quality assessment:

    • SDS-PAGE and Western blotting to confirm identity

    • Circular dichroism to assess secondary structure integrity

    • Blue native PAGE to evaluate oligomeric state

This purification strategy accounts for both the membrane protein nature of NuoA and its psychrophilic origin, maximizing the likelihood of obtaining functional protein for subsequent analyses .

How can researchers assess the functional integrity of recombinant P. cryohalolentis NuoA?

Assessing the functional integrity of recombinant NuoA presents challenges as it normally functions as part of the larger Complex I. Several complementary approaches can be employed:

  • Reconstitution studies:

    • Reconstitute NuoA with other Complex I subunits from P. cryohalolentis or related organisms

    • Measure reconstitution efficiency using blue native PAGE

    • Assess partial complex assembly using crosslinking approaches

  • Proton translocation assays:

    • Reconstitute NuoA into liposomes containing pH-sensitive fluorescent dyes

    • Monitor pH changes upon addition of substrates

    • Compare activity at different temperatures (0-25°C)

  • Binding assays:

    • Assess protein-protein interactions with other Complex I subunits using microscale thermophoresis

    • Measure binding affinities at different temperatures

    • Compare wild-type and mutant NuoA binding properties

  • Complementation studies:

    • Create nuoA knockout in P. cryohalolentis using transposon mutagenesis

    • Complement with recombinant nuoA variants

    • Assess respiratory capacity and growth at low temperatures

  • Structural integrity:

    • Use limited proteolysis to assess proper folding

    • Thermal shift assays to determine stability (modified for cold-adapted proteins)

    • Circular dichroism to monitor secondary structure at varying temperatures

These approaches provide complementary information about different aspects of NuoA function and can be tailored based on specific research questions and available resources .

How does P. cryohalolentis Complex I compare to other bacterial Complex I systems?

Phylogenomic analysis of bacterial Complex I has revealed five main clades (A-E), each with distinctive features . While the specific clade of P. cryohalolentis Complex I is not explicitly mentioned in the search results, comparative analysis would provide valuable insights:

Complex I FeatureVariation Across Bacterial CladesRelevance to P. cryohalolentis Research
NuoCD fusionAlmost exclusively in clade EDetermining if P. cryohalolentis has fused or separate NuoC and NuoD provides phylogenetic context
NuoE lengthRanges from 166-457 amino acidsAnalysis of P. cryohalolentis NuoE length helps classify its Complex I type
NuoG lengthRanges from 493-894 amino acidsShort vs. long NuoG correlates with different Complex I clades
Iron-sulfur cluster N7Common in clades D and E, rare in A and BPresence of N7 binding motif affects stability and potentially cold adaptation

Understanding where P. cryohalolentis Complex I fits within this evolutionary framework provides context for interpreting experimental results and potentially predicting functional characteristics based on related organisms. Additionally, as a psychrophilic organism, P. cryohalolentis may display unique adaptations within its clade, making comparative analysis particularly valuable .

What insights can be gained from comparing mesophilic and psychrophilic Complex I?

Comparative analysis of P. cryohalolentis Complex I with mesophilic counterparts can reveal fundamental adaptations for cold activity:

  • Amino acid composition trends:

    • Psychrophilic enzymes typically show increased glycine content

    • Reduced proline and arginine content in loop regions

    • Higher proportion of hydrophobic residues with small side chains

  • Structural flexibility analysis:

    • Psychrophilic enzymes often show regions of increased flexibility

    • Key catalytic regions may maintain rigidity while peripheral regions become more flexible

    • Modified ion pair networks that maintain stability at lower temperatures

  • Energy coupling efficiency:

    • Potential modifications in proton translocation efficiency

    • Adaptations in quinone binding site to maintain activity at low temperatures

    • Altered conformational change mechanisms coupling electron transfer to proton pumping

  • Temperature-dependent kinetics:

    • Lower activation energy in psychrophilic enzymes

    • Higher catalytic efficiency (kcat/Km) at low temperatures

    • Potentially different rate-limiting steps compared to mesophilic homologs

Analyzing these features in P. cryohalolentis Complex I, particularly the NuoA subunit, would contribute to our broader understanding of enzymatic cold adaptation and potentially inspire biomimetic applications for low-temperature bioenergetics .

How can researchers address experimental challenges in work with P. cryohalolentis Complex I?

Working with Complex I from psychrophilic organisms presents unique challenges that require specialized approaches:

  • Temperature management during purification:

    • Maintain consistently low temperatures throughout isolation

    • Develop cold room protocols for all chromatography steps

    • Use temperature-controlled systems for all functional assays

  • Activity assay optimization:

    • Modify standard Complex I assays for low-temperature conditions

    • Account for temperature effects on substrate solubility and detector responses

    • Develop temperature calibration curves for accurate comparisons

  • Data normalization and comparison:

    • When comparing to mesophilic enzymes, normalize data considering temperature-dependency

    • Use temperature coefficients (Q10) to model activity differences

    • Develop mathematical models accounting for temperature effects on kinetic parameters

  • Structural biology challenges:

    • Crystal growth may require different conditions for psychrophilic proteins

    • Cryo-EM sample preparation must account for inherent cold stability

    • Consider native-state mass spectrometry at controlled low temperatures

  • Genetic manipulation approaches:

    • Utilize established transposon mutagenesis protocols for P. cryohalolentis

    • Optimize transformation conditions for cold-adapted organisms

    • Develop genetic tools specifically adapted for psychrophilic bacteria

These methodological considerations help address the inherent challenges of working with cold-adapted respiratory complexes and ensure that experimental results accurately reflect the natural properties of P. cryohalolentis Complex I .

What are promising areas for future research on P. cryohalolentis Complex I?

Several high-priority research directions would significantly advance our understanding of P. cryohalolentis Complex I:

  • Structural biology:

    • Determine high-resolution structure of P. cryohalolentis Complex I

    • Compare with mesophilic Complex I structures to identify cold-adaptive features

    • Investigate temperature-dependent conformational changes

  • Bioenergetic characterization:

    • Determine H+/e- stoichiometry at different temperatures

    • Investigate reverse electron transport capabilities

    • Characterize temperature dependence of electron transfer efficiency

  • Systems biology approaches:

    • Analyze Complex I expression under different growth conditions

    • Investigate integration with other aspects of P. cryohalolentis metabolism

    • Study regulatory networks controlling respiratory chain composition

  • Biotechnological applications:

    • Explore potential for cold-active biofuel cells

    • Investigate bioremediation applications in cold environments

    • Develop biosensors functional at low temperatures

  • Evolutionary analysis:

    • Comprehensive comparative genomics of Complex I across psychrophilic bacteria

    • Molecular clock analysis to date adaptations to cold environments

    • Horizontal gene transfer analysis of respiratory chain components

Each of these research directions would contribute to our fundamental understanding of cold adaptation in respiratory systems and potentially lead to novel biotechnological applications leveraging the unique properties of P. cryohalolentis Complex I .

How might CRISPR-Cas9 technologies advance P. cryohalolentis Complex I research?

CRISPR-Cas9 gene editing technologies offer powerful approaches to advance P. cryohalolentis Complex I research beyond traditional mutagenesis methods :

  • Precise genetic modifications:

    • Create targeted mutations in nuoA and other Complex I genes

    • Introduce site-specific modifications to test structure-function hypotheses

    • Generate chimeric proteins combining domains from psychrophilic and mesophilic organisms

  • Regulatory studies:

    • Modify promoter regions to alter expression patterns

    • Create reporter gene fusions to monitor Complex I expression

    • Develop inducible systems for controlled expression

  • High-throughput approaches:

    • Generate comprehensive libraries of nuoA variants

    • Screen for variants with enhanced cold activity or thermal stability

    • Identify residues critical for cold adaptation

  • System-wide analysis:

    • Multiplex CRISPR modifications to study respiratory chain component interactions

    • Create knockdowns of alternative respiratory pathways

    • Investigate genetic interactions through synthetic lethality screens

  • Adaptation studies:

    • Track real-time evolution of Complex I under different temperature regimes

    • Identify compensatory mutations in response to primary Complex I modifications

    • Study horizontal gene transfer of respiratory components in environmental conditions

These CRISPR-based approaches would significantly accelerate our understanding of P. cryohalolentis Complex I function and adaptation, providing more precise tools than the transposon mutagenesis approaches currently documented .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.