Recombinant Psychrobacter cryohalolentis NADH-quinone oxidoreductase subunit K (nuoK)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment of your requirements.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment of your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
The tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
nuoK; Pcryo_0582; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-135
Protein Length
full length protein
Species
Psychrobacter cryohalolentis (strain K5)
Target Names
nuoK
Target Protein Sequence
MVLAASVVQEVANVPFAHEVAGLVQPVAEAQNVLGLIPMSHGLILAGILFAIGLCGVMVR
RNFLFMLMSLEIMMNAAALAFVVAGSRWVDPDGQIMFIFILTLAAAEAAIGLAILLRFYH
QRGHLDVDSANEMKG
Uniprot No.
Target Background
Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled to proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, conserving energy as a proton gradient.
Database Links
KEGG: pcr:Pcryo_0582
STRING: 335284.Pcryo_0582
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
