Recombinant Psychrobacter cryohalolentis UPF0059 membrane protein Pcryo_0007 (Pcryo_0007)

What is Psychrobacter cryohalolentis Pcryo_0007 protein and what are its basic characteristics?

Pcryo_0007 (UniProt ID: Q1QEW2) is a full-length membrane protein (197 amino acids) from Psychrobacter cryohalolentis that functions as a putative manganese efflux pump (mntP1). The protein contains multiple transmembrane domains characteristic of transport proteins. The amino acid sequence is: MDIEMIEVILLAIALAMDAFAVSIGLGAKSQKQSSAYVLRLAVYAALYFGIAQGVMPLIG YLLGAVLLGWLATAAPWLGGGILILLGAKMLYEAFNGEIEAVLEDSFDRNMQEKINHRMM FTLAIATSIDAMAAGFTLNLLALNAWLACSIIAIVTAGFGFFGIYLGKSSGTWLEDKAEI LGGLVLIAIGIKVMFIR .

This membrane protein is part of a broader system of proteins in P. cryohalolentis that allow this extremophile to survive in cold, salty environments with growth temperatures ranging from -10°C to 30°C . When expressed recombinantly, the protein is typically fused to an N-terminal His tag and produced in E. coli expression systems .

How should Recombinant Pcryo_0007 be stored and reconstituted for optimal stability?

For optimal stability, recombinant Pcryo_0007 should be stored as follows:

• Upon receipt, briefly centrifuge the vial to bring contents to the bottom

• Store the lyophilized powder at -20°C/-80°C

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (50% is recommended)

• Aliquot the solution to avoid repeated freeze-thaw cycles

• Store working aliquots at 4°C for up to one week

The protein is supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during lyophilization and storage . Repeated freeze-thaw cycles should be avoided as they may cause protein degradation and loss of activity. For long-term storage, keeping the protein at -80°C in small aliquots with added glycerol is recommended.

What expression systems are most effective for producing recombinant Pcryo_0007?

E. coli expression systems have been demonstrated to be effective for the recombinant production of Pcryo_0007 . When expressing membrane proteins like Pcryo_0007, several considerations are important:

• Codon optimization: Adapting the coding sequence to E. coli codon usage can improve expression levels

• Fusion tags: The N-terminal His tag not only aids in purification but can also improve solubility

• Temperature modulation: Lower expression temperatures (15-20°C) often improve membrane protein folding

• Specialized E. coli strains: Strains like C41(DE3) or C43(DE3) that are adapted for membrane protein expression may yield better results

• Detergent selection: Careful selection of detergents for extraction and purification is critical for maintaining protein functionality

The recombinant protein can be purified to greater than 90% purity as determined by SDS-PAGE . For functional studies, it's important to consider that the protein's activity may be dependent on proper membrane reconstitution.

How does Pcryo_0007 relate to other characterized proteins in the biosynthetic pathways of P. cryohalolentis?

While Pcryo_0007 functions as a putative manganese efflux pump, P. cryohalolentis contains several other well-characterized enzymes involved in complex biosynthetic pathways, particularly those related to unusual sugar biosynthesis for its O-antigen structure.

The O-antigen of P. cryohalolentis K5T contains l-rhamnose, d-galactose, two diacetamido-sugars, and one triacetamido-sugar . Key enzymes in these pathways include:

• Pcryo_0638: A pyridoxal 5'-phosphate (PLP)-dependent aminotransferase with kinetic parameters of KM = 0.29 ± 0.04 mM and kcat = 1.9 ± 0.2 s-1 for UDP-4-keto-6-deoxy-N-acetyl-d-glucosamine

• Pcryo_0637: An N-acetyltransferase with kinetic parameters of:

  • KM = 0.62 ± 0.05 mM and kcat = 545 ± 40 s-1 for UDP-2-acetamido-4-amino-2,4,6-trideoxy-d-glucose

  • KM = 0.070 ± 0.008 mM and kcat = 1900 ± 200 s-1 for acetyl-CoA

• Additional enzymes involved in the biosynthesis of 2,3-diacetamido-2,3-dideoxy-d-glucuronic acid include Pcryo_0613 (UDP-N-acetyl-d-glucosamine 6-dehydrogenase), Pcryo_0614 (NAD+-dependent dehydrogenase), Pcryo_0616 (PLP-dependent aminotransferase), and Pcryo_0615 (N-acetyltransferase)

Understanding the relationship between Pcryo_0007 and these biosynthetic enzymes could provide insights into how manganese homeostasis might affect O-antigen biosynthesis in P. cryohalolentis, particularly under cold stress conditions.

What structural features of Pcryo_0007 contribute to its function in cold environments?

As a membrane protein from a psychrophilic organism, Pcryo_0007 likely possesses several adaptations that enable function at low temperatures:

• Membrane fluidity adaptations: The amino acid composition (MDIEMIEVILLAIALAMDAFAVSIGLGAKSQKQSSAYVLRLAVYAALYFGIAQGVMPLIGYLLGAVLLGWLATAAPWLGGGILILLGAKMLYEAFNGEIEAVLEDSFDRNMQEKINHRMM FTLAIATSIDAMAAGFTLNLLALNAWLACSIIAIVTAGFGFFGIYLGKSSGTWLEDKAEILGGLVLIAIGIKVMFIR) suggests multiple transmembrane domains with specific amino acid distributions that likely maintain functionality in cold, fluid membranes.

• Flexibility in key functional regions: Psychrophilic proteins often show increased flexibility in catalytic regions to compensate for reduced molecular motion at low temperatures.

• Reduced hydrophobic core packing: The transmembrane regions may have looser packing to maintain flexibility at low temperatures.

• Cold-responsive regulatory elements: The expression and activity of Pcryo_0007 may be regulated by temperature-responsive elements.

Comparative structural analysis with mesophilic homologs would be valuable for identifying specific cold-adaptive features. High-resolution structural studies similar to those performed on other P. cryohalolentis proteins would provide insights into the mechanisms of cold adaptation.

How can researchers effectively study the kinetics of metal transport by Pcryo_0007?

Studying the metal transport kinetics of Pcryo_0007 requires specialized methodologies:

• Reconstitution into liposomes: The purified protein must be incorporated into artificial membrane systems to study transport function.

• Metal uptake assays: Fluorescent metal indicators or isotope-labeled metals (55Mn) can be used to track metal transport in real-time.

• Stopped-flow spectroscopy: This technique allows for measurement of rapid kinetics of metal binding and transport.

• Site-directed mutagenesis: Identifying key residues involved in metal binding and transport by systematic mutation.

• Temperature-dependent assays: Since P. cryohalolentis grows at temperatures between -10°C and 30°C , kinetic measurements should be performed across this temperature range to understand cold adaptation.

These approaches can be complemented by computational modeling based on the amino acid sequence to predict metal-binding sites and transport pathways. When designing reconstitution systems, it's crucial to consider membrane composition that mimics the native environment of P. cryohalolentis.

What are the best approaches for analyzing Pcryo_0007 interactions with other cellular components?

To analyze Pcryo_0007 interactions with other cellular components, consider these methodological approaches:

• Co-immunoprecipitation: Using anti-His antibodies to pull down Pcryo_0007 and identify interacting partners by mass spectrometry.

• Bacterial two-hybrid systems: Adapted for membrane proteins to identify protein-protein interactions.

• Cross-linking mass spectrometry: Chemical cross-linking followed by MS analysis can capture transient interactions.

• Proximity labeling: BioID or APEX2 fusions can identify proteins in close proximity to Pcryo_0007 in vivo.

• Fluorescence microscopy: Localization studies using fluorescent protein fusions can reveal compartmentalization patterns.

For each approach, consideration should be given to the cold-adapted nature of P. cryohalolentis. Interaction studies at different temperatures (4°C, 15°C, 30°C) might reveal temperature-dependent associations that are functionally relevant to the organism's ability to thrive in cold environments .

How should researchers design experiments to study Pcryo_0007 function in the context of cold adaptation?

When designing experiments to study cold adaptation of Pcryo_0007:

• Temperature-controlled assays: Set up parallel experiments at multiple temperatures (-10°C, 0°C, 10°C, 20°C, 30°C) to capture the full functional range of the protein.

• Membrane composition analysis: Compare protein activity in membranes with different lipid compositions that mimic cold-adapted vs. mesophilic bacteria.

• Comparative analysis: Include homologous proteins from mesophilic relatives as controls to highlight cold-specific adaptations.

• In vivo functional studies: Create knockout/complementation systems to study the protein's role in manganese homeostasis under cold stress.

• Thermal stability assays: Use differential scanning calorimetry or thermal shift assays to determine protein stability across temperature ranges.

P. cryohalolentis has been shown to function at temperatures as low as -10°C and in environments with significant salt concentrations , so experimental conditions should reflect these extremes to properly evaluate cold-adaptive features.

What techniques are recommended for analyzing the membrane topology and structural features of Pcryo_0007?

For analyzing membrane topology and structural features of Pcryo_0007:

• Cysteine scanning mutagenesis: Introducing single cysteine residues at various positions followed by accessibility labeling can map membrane-embedded regions.

• Protease protection assays: Limited proteolysis of the reconstituted protein can identify exposed loops.

• Cryo-electron microscopy: This technique has proven valuable for membrane protein structure determination and could reveal cold-adaptive features.

• Molecular dynamics simulations: Using the amino acid sequence to model protein behavior in membranes at different temperatures.

• EPR spectroscopy: Spin-labeling specific residues can provide information about dynamics and conformational changes during transport.

• Hydrogen-deuterium exchange mass spectrometry: This can reveal flexible regions and conformational dynamics relevant to cold adaptation.

The high-resolution structural determination approaches used for other P. cryohalolentis proteins (such as Pcryo_0637 at 1.3 Å resolution) provide excellent templates for structural work on Pcryo_0007.

How can Pcryo_0007 research be integrated with studies of bacterial cold adaptation mechanisms?

Integrating Pcryo_0007 research with broader cold adaptation studies:

• Systems biology approaches: Combine transcriptomics, proteomics, and metabolomics to understand how Pcryo_0007 expression changes under different temperature conditions.

• Comparative genomics: Analyze the conservation and evolution of mntP1/Pcryo_0007 across psychrophilic, psychrotolerant, and mesophilic bacteria.

• Metabolic network analysis: Determine how manganese homeostasis connects to other cold-responsive pathways in P. cryohalolentis.

• Ecological context: Study the role of manganese transport in natural cold environments where P. cryohalolentis was isolated.

• Multi-protein complex analysis: Investigate whether Pcryo_0007 functions as part of larger cold-responsive membrane complexes.

P. cryohalolentis has been noted for its applications in cold storage of vegetables due to its psychrophilic and antimicrobial properties , suggesting research on its membrane proteins like Pcryo_0007 could have both fundamental and applied significance.

What are the recommended approaches for studying potential applications of Pcryo_0007 in biotechnology?

For biotechnological applications of Pcryo_0007:

• Cold-active bioremediation: Evaluate if Pcryo_0007 can be utilized in engineered bacteria for metal bioremediation in cold environments.

• Heterologous expression: Test if introducing Pcryo_0007 into mesophilic bacteria can enhance their cold tolerance.

• Protein engineering: Identify specific cold-adaptive features that could be transferred to other membrane proteins.

• Biosensor development: Explore the potential use of Pcryo_0007 in manganese detection systems for environmental monitoring.

• Structure-based drug design: The unique features of psychrophilic membrane proteins could provide templates for developing antimicrobials active at low temperatures.

Given P. cryohalolentis's demonstrated activity in cold storage applications (4°C and below) , proteins like Pcryo_0007 may have untapped potential in low-temperature biotechnological processes.

What are common challenges in expressing and purifying Pcryo_0007, and how can they be addressed?

Common challenges and solutions in Pcryo_0007 expression and purification:

• Challenge: Low expression yields
  Solution: Optimize codon usage, use specialized E. coli strains like C41(DE3), and test expression at multiple temperatures (15-20°C often optimal)

• Challenge: Protein aggregation
  Solution: Add stabilizing agents like glycerol (5-50%), trehalose (6%), and appropriate detergents during purification

• Challenge: Maintaining native conformation
  Solution: Reconstitute in lipid environments that mimic the native membrane composition of P. cryohalolentis

• Challenge: Functional assays at low temperatures
  Solution: Develop specialized low-temperature activity assays with temperature-controlled equipment

• Challenge: Protein stability during storage
  Solution: Store as recommended with glycerol at -80°C in small aliquots to prevent freeze-thaw damage

Careful attention to buffer composition and pH (Tris/PBS-based buffer, pH 8.0) is essential for maintaining protein stability throughout the purification process.

How can researchers effectively validate the functional activity of recombinant Pcryo_0007?

To validate functional activity of recombinant Pcryo_0007:

• Metal transport assays: Quantify manganese transport using fluorescent indicators or radioisotopes

• ATPase activity measurements: If transport is coupled to ATP hydrolysis, measure ATP consumption rates

• Complementation studies: Test if recombinant Pcryo_0007 can restore function in manganese transport-deficient bacterial strains

• Metal binding assays: Use isothermal titration calorimetry or fluorescence spectroscopy to quantify metal binding

• Conformational change detection: Monitor protein structural changes upon metal binding using circular dichroism or fluorescence spectroscopy

Each assay should be conducted at multiple temperatures relevant to P. cryohalolentis growth range (-10°C to 30°C) to understand temperature-dependent functional characteristics.