Recombinant Psychrobacter cryohalolentis UPF0059 membrane protein Pcryo_1339 (Pcryo_1339)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP2; Pcryo_1339; Putative manganese efflux pump MntP 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Psychrobacter cryohalolentis (strain K5)
Target Names
mntP2
Target Protein Sequence
MLEVLLLALALAADAFAASIGLGSTHKSDVNSQFMKMALLIGVYFGVAQGVMPLIGYALG STMLGWFAEGASWVAFVILVALGIKMLYESRSVNNDETRINLSHKTLLSLAIATSLDAMG AGFTLNLLAVNAYLACLIIALTTAVLSVLGAYIGRKSGTWLGSWAEALGGLVLIAIGVNM VV
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Psychrobacter cryohalolentis and what are its distinctive characteristics?

Psychrobacter cryohalolentis K5T is a Gram-negative bacterium first isolated from Siberian permafrost in 2006 . It belongs to the genus Psychrobacter, which was first proposed in 1986 with the isolation of Psychrobacter immobilis . These bacteria are remarkable for their ability to survive in extreme cold environments.

P. cryohalolentis has a complex O-antigen structure containing L-rhamnose, D-galactose, two diacetamido-sugars, and one triacetamido-sugar . The biochemical pathways for producing these unusual sugars make this organism particularly interesting for researchers studying carbohydrate biosynthesis in extremophiles.

While considered an opportunistic pathogen, related strains have been isolated from human blood, cerebrospinal fluid, urine, and cutaneous sources . Recent clinical cases include an infection of a 26-year-old man after suffering a hand laceration while crabbing in Puget Sound .

What expression systems are recommended for recombinant Pcryo_1339 production?

For recombinant production of Pcryo_1339, Escherichia coli expression systems have been successfully employed . When expressing membrane proteins like Pcryo_1339, several considerations should be taken into account:

  • Expression vector selection: Vectors with N-terminal His tags have been successfully used for Pcryo_1339 .

  • Host strain optimization: While specific strains for Pcryo_1339 expression are not detailed in the provided literature, BL21(DE3) and its derivatives are commonly used for membrane protein expression.

  • Alternative expression systems: For challenging membrane proteins, cell-free expression systems like ALiCE can be considered, as they have shown comparable activity to cell-based expression systems for other membrane proteins .

The choice between these systems depends on the research goals - whether structural studies requiring high purity or functional studies requiring properly folded protein are planned.

What are the optimal experimental designs for studying Pcryo_1339 gene expression using qPCR?

When designing qPCR experiments to study Pcryo_1339 gene expression, researchers should consider a more efficient experimental design and analysis procedure than traditional approaches .

Traditional vs. Dilution-Replicate Experimental Design:

Design AspectTraditional MethodDilution-Replicate Method
Replication strategyIdentical replicates (typically 3) for each sampleSingle reaction at multiple dilutions for each sample
PCR efficiency determinationSeparate standard curves from 2-3 independent samplesEfficiency determined from each sample's dilution curve
Number of reactionsHigherLower
Inter-run variation controlRequires identical samples across runsEach sample estimates efficiency for inter-run comparison

The dilution-replicate design offers several advantages :

  • Fewer total reactions required

  • Each sample provides an independent estimate of PCR efficiency

  • Less influenced by individual outlier Cq values

For Pcryo_1339 expression analysis, the recommended approach is to use a constrained-fit (identical slope) method for data analysis, which provides more consistent results compared with independent fitting of each sample .

What membrane protein purification strategies are most effective for Pcryo_1339?

While specific purification protocols for Pcryo_1339 are not detailed in the literature reviewed, general principles for similar membrane proteins can be applied:

  • Initial solubilization: Use appropriate detergents like DDM, LDAO, or C12E8 to extract the protein from the membrane.

  • Affinity chromatography: Utilize the N-terminal His-tag for initial purification via immobilized metal affinity chromatography (IMAC) .

  • Buffer optimization: Tris/PBS-based buffer with 6% Trehalose at pH 8.0 has been used for storage of the purified protein .

  • Storage considerations: The purified protein can be lyophilized or stored in solution with 50% glycerol at -20°C/-80°C . Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

  • Reconstitution: Deionized sterile water is recommended for reconstitution to a concentration of 0.1-1.0 mg/mL .

How can researchers design effective experiments to study Pcryo_1339 function and activity?

Designing experiments to study the function of Pcryo_1339 requires careful consideration of experimental design principles. Based on the literature, several approaches can be recommended:

Quasi-Experimental Design Options:

Design TypeStructureAdvantagesLimitations
Time-Series DesignO₁ O₂ O₃ O₄ O₅ X O₆ O₇ O₈ O₉ O₁₀Controls for temporal trendsCannot control for confounding external events
One-Group Pretest-PosttestO₁ X O₂Simple implementationLimited control for maturation effects
Removed-Treatment DesignO₁ X O₂ O₃ removeX O₄Tests effect of both adding and removing interventionEthical issues if intervention provides benefit
Switching-ReplicationsIntervention group: O₁ₐ X O₂ₐ O₃ₐ
Control group: O₁ᵦ O₂ᵦ X O₃ᵦ
Strong internal validityRequires multiple groups and measurements

Where O = Observational Measurement; X = Intervention Under Study .

For membrane proteins like Pcryo_1339, activity assays could include:

  • Transport assays: Measuring manganese ion flux in proteoliposomes or membrane vesicles

  • Binding assays: Determining affinity for potential substrates

  • Mutational analysis: Examining the effect of mutations on transport activity

What approaches are recommended for structural studies of Pcryo_1339?

Structural studies of membrane proteins like Pcryo_1339 present unique challenges. Based on successful approaches with other Psychrobacter cryohalolentis proteins, the following strategies are recommended:

  • X-ray crystallography: High-resolution structures of other P. cryohalolentis proteins have been determined to resolutions as high as 1.0-1.8 Å . Key considerations include:

    • Crystal growth conditions: PEG-based precipitants with various salts

    • Crystallization in the presence of ligands or inhibitors to stabilize the protein

  • Cryo-electron microscopy: For challenging membrane proteins where crystallization is difficult.

  • Computational modeling: Homology modeling based on related structures can provide preliminary structural insights.

For Pcryo_1339 specifically, researchers should consider the following parameters based on successful crystallization of other P. cryohalolentis proteins:

ParameterRange to Explore
ResolutionTarget: 1.3-1.8 Å
Space groupP1 (triclinic) has been successful for other P. cryohalolentis proteins
Temperature4°C during purification, 20°C for crystallization
Buffer components50 mM Tris/PBS, pH 7.5-8.5

How can researchers study the membrane topology and insertion of Pcryo_1339?

Understanding how Pcryo_1339 inserts into membranes is crucial for functional studies. Research on peroxisomal membrane proteins provides applicable methodologies :

  • Tracking membrane insertion pathway: Evidence suggests that many membrane proteins first target to the endoplasmic reticulum (ER) before reaching their final destination . To study this for Pcryo_1339:

    • Create fluorescently tagged versions (e.g., YFP-Pcryo_1339)

    • Track appearance in different cellular compartments using fluorescence microscopy

    • Use subcellular fractionation to biochemically verify localization

  • Determining membrane insertion machinery:

    • Investigate the role of Sec61p translocon or Get3 protein in Pcryo_1339 membrane insertion

    • Use in vitro translation systems with ER-derived microsomes

  • Topology mapping:

    • Protease protection assays to determine cytoplasmic vs. periplasmic domains

    • Cysteine accessibility methods using membrane-permeable and impermeable thiol reagents

    • Fluorescence quenching with lipid-soluble quenchers

What are the best approaches for studying Pcryo_1339's potential role in manganese transport?

As a putative manganese efflux pump (MntP2), Pcryo_1339's transport function can be studied using several complementary approaches:

  • In vivo functional complementation:

    • Express Pcryo_1339 in manganese transport-deficient bacterial strains

    • Measure growth recovery under manganese stress conditions

  • Transport assays:

    • Reconstitute purified Pcryo_1339 into proteoliposomes

    • Measure manganese flux using radioactive tracers (⁵⁴Mn) or fluorescent indicators

    • Monitor transport kinetics under various conditions (pH, temperature, competing ions)

  • Metal binding studies:

    • Isothermal titration calorimetry (ITC) to measure binding affinity

    • Intrinsic fluorescence quenching upon metal binding

    • Circular dichroism to detect conformational changes upon binding

  • Site-directed mutagenesis:

    • Identify putative metal-binding residues based on sequence analysis

    • Create point mutations and assess impact on transport activity

How can researchers analyze data from Pcryo_1339 transport assays effectively?

Data analysis for membrane protein transport assays requires careful statistical consideration. Based on principles from similar studies, the following approaches are recommended:

  • Kinetic parameter determination:

    • Employ Michaelis-Menten kinetics to determine Km and Vmax values

    • Use Lineweaver-Burk or Eadie-Hofstee plots for visualization

  • Statistical analysis of experimental designs:

    • For factorial experiments designed to test multiple factors (e.g., pH, temperature, substrate concentration), use ANOVA to assess individual and interaction effects

    • For randomized block designs, use block analysis to control for variations between protein preparations

  • Data visualization:

    • Create semi-log plots for parameters that follow exponential relationships

    • Use constrained fitting approaches when analyzing PCR data to minimize the impact of outliers

What are the key considerations for designing mutagenesis studies of Pcryo_1339?

Site-directed mutagenesis is a powerful approach for understanding structure-function relationships in membrane proteins like Pcryo_1339:

  • Target residue selection:

    • Conserved motifs in the UPF0059 membrane protein family

    • Predicted transmembrane domains based on hydrophobicity analysis

    • Putative metal-binding sites (histidine, aspartate, glutamate residues)

  • Mutagenesis strategy:

    • Alanine scanning of conserved residues

    • Conservative substitutions to probe chemical requirements

    • Introduction or removal of potential glycosylation sites

  • Functional assessment:

    • Compare transport activity of mutants vs. wild-type

    • Analyze changes in metal-binding affinity

    • Assess protein stability and membrane insertion efficiency

  • Controls:

    • Include mutations in non-conserved regions as negative controls

    • Verify expression levels and membrane localization for all mutants

How can researchers overcome challenges in recombinant expression of Pcryo_1339?

Membrane proteins often present challenges for recombinant expression. Based on successful strategies for similar proteins, consider:

  • Expression optimization:

    • Test multiple promoter strengths and induction conditions

    • Evaluate expression in different E. coli strains (C41/C43, Lemo21)

    • Consider codon optimization for E. coli expression

  • Fusion partners:

    • N-terminal fusion partners like MBP or SUMO can improve solubility

    • C-terminal GFP fusions allow rapid assessment of folding quality

  • Alternative expression systems:

    • Cell-free systems have shown success with membrane proteins

    • The ALiCE expression system has demonstrated activity comparable to cell-based expression for cannabinoid receptors

  • Co-expression strategies:

    • Co-express with chaperones to assist folding

    • Consider co-expression with interaction partners if known

How should researchers approach comparative studies between Pcryo_1339 and related proteins?

Comparative analysis between Pcryo_1339 and related manganese transporters can provide valuable insights:

  • Phylogenetic analysis:

    • Construct maximum-likelihood trees of MntP homologs

    • Identify conserved and divergent regions that may reflect adaptation to cold environments

  • Functional comparison:

    • Express Pcryo_1339 alongside MntP proteins from mesophilic organisms

    • Compare transport activity across temperature ranges (0-37°C)

    • Analyze thermal stability differences

  • Structural comparison:

    • Use homology modeling to predict structural differences

    • If structures are available, compare binding sites and conformational states

  • Experimental design considerations:

    • Use factorial experimental designs to systematically compare proteins across multiple variables

    • Employ randomized block designs to control for variations in experimental conditions

What are the ethical and safety considerations when working with recombinant Pcryo_1339?

When working with recombinant proteins derived from Psychrobacter cryohalolentis, researchers should be aware of:

  • Biosafety considerations:

    • P. cryohalolentis is considered an opportunistic pathogen with clinical cases reported

    • Follow appropriate biosafety level guidelines for the organism

    • Take standard precautions when handling recombinant proteins (proper PPE, no mouth pipetting)

  • Research ethics:

    • Products like recombinant Pcryo_1339 are labeled "Not For Human Consumption"

    • Ensure proper documentation and approval for research use

  • Environmental considerations:

    • Proper disposal of bacterial cultures and recombinant materials

    • Prevention of accidental release of recombinant organisms

How can contradictory results in Pcryo_1339 research be reconciled?

When faced with contradictory results in membrane protein research, consider these approaches:

  • Systematic methodology assessment:

    • Compare experimental conditions in detail (buffer composition, detergents, temperature)

    • Verify protein integrity through multiple methods (SDS-PAGE, Western blot, mass spectrometry)

    • Assess the impact of different expression tags on protein function

  • Statistical analysis approaches:

    • Use constrained fitting methods for qPCR data to minimize outlier effects

    • Apply appropriate statistical tests based on experimental design (t-tests, ANOVA)

    • Consider meta-analysis approaches when sufficient published data exists

  • Independent verification:

    • Test functional properties using multiple complementary assays

    • Verify key findings in different expression systems

    • Collaborate with other laboratories to independently reproduce results

  • Reconciliation strategies:

    • Consider protein microheterogeneity (different conformational states)

    • Explore environmental factors that may influence protein behavior (pH, temperature, ionic strength)

    • Investigate the influence of experimental design on outcomes using quasi-experimental approaches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.