Recombinant Psychrobacter cryohalolentis UPF0060 membrane protein Pcryo_1498 (Pcryo_1498)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Pcryo_1498; UPF0060 membrane protein Pcryo_1498
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Psychrobacter cryohalolentis (strain K5)
Target Names
Pcryo_1498
Target Protein Sequence
MSELKTVGLFALTALAEIAGCYLPYLWLREGKSVWLLIPGALSLIAFVWLLSLHPTAAGR VYAAYGGVYISMVILWLWTVNGIRPTTWDIVGSAIALLGMAIIMFAPRSA
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does Psychrobacter cryohalolentis UPF0060 membrane protein differ from other membrane proteins in the UPF0060 family?

The UPF0060 membrane protein family encompasses proteins with unknown functions across various bacterial species. Psychrobacter cryohalolentis UPF0060 membrane protein Pcryo_1498 distinguishes itself through several key characteristics:

  • Psychrophilic adaptation: Unlike many other UPF0060 family members, Pcryo_1498 originates from a cold-adapted bacterium, featuring amino acid compositions that favor protein flexibility at low temperatures.

  • Sequence conservation: While maintaining the core structural elements of the UPF0060 family, Pcryo_1498 has distinctive regions, particularly in its transmembrane domains.

  • Size and domain organization: At 110 amino acids, Pcryo_1498 represents one of the more compact members of this protein family, lacking some of the extended loops or domains present in homologs from other bacteria.

When conducting comparative analyses, researchers should employ multiple sequence alignment techniques with other UPF0060 family members to identify conserved regions that may indicate functional sites. This approach helps distinguish between general UPF0060 family characteristics and features unique to the Psychrobacter cryohalolentis variant .

What are the optimal conditions for reconstitution and storage of recombinant Pcryo_1498 protein?

For optimal handling of recombinant Pcryo_1498 protein, follow these methodological guidelines:

Reconstitution Protocol:

  • Centrifuge the vial briefly before opening to ensure the lyophilized powder is at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended standard: 50%)

  • Aliquot for long-term storage to prevent repeated freeze-thaw cycles

Storage Conditions:

  • Store reconstituted protein at -20°C/-80°C for long-term preservation

  • Working aliquots can be maintained at 4°C for up to one week

  • Store in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Avoid repeated freeze-thaw cycles as this can significantly reduce protein activity

The protein stability can be monitored through regular activity assays or SDS-PAGE analysis. For research requiring extended use of the protein, aliquoting immediately after reconstitution is critical to maintain protein integrity .

What experimental design considerations are essential when working with membrane proteins like Pcryo_1498?

When designing experiments with membrane proteins like Pcryo_1498, researchers must address several critical considerations:

Experimental Design Framework:

  • Solubilization strategy: Membrane proteins require careful selection of detergents or lipid systems for proper solubilization while maintaining native structure. For Pcryo_1498, consider using mild non-ionic detergents like DDM or LDAO at concentrations just above their critical micelle concentration.

  • Replication requirements: Design experiments with adequate biological and technical replicates to account for the inherent variability in membrane protein behavior.

  • Control selection: Include both positive controls (well-characterized membrane proteins) and negative controls (buffer-only or irrelevant protein controls) to validate experimental outcomes.

  • Factor consideration: Account for environmental factors that may affect membrane protein stability, including:

    • Temperature variations

    • pH conditions

    • Ionic strength

    • Presence of specific lipids or cofactors

  • Randomization strategy: Implement randomization in your experimental design to minimize systematic errors, particularly important when comparing multiple conditions or treatments .

For structural studies, consider employing advanced techniques like circular dichroism to assess secondary structure integrity following purification and reconstitution procedures. The experimental design should include validation steps to confirm proper membrane insertion and orientation, especially when studying function.

What bioinformatic approaches are most effective for predicting the structure and function of Pcryo_1498?

Given the challenges of experimental structure determination for membrane proteins like Pcryo_1498, computational approaches offer valuable insights into potential structure and function:

Recommended Bioinformatic Protocol:

  • Sequence-based analysis:

    • Use TMHMM, HMMTOP, or Phobius to predict transmembrane regions

    • Apply SignalP to identify potential signal peptides

    • Employ PFAM domain prediction to identify conserved domains

  • Structural prediction:

    • AlphaFold2 or RoseTTAFold for de novo structure prediction

    • I-TASSER for threading-based modeling

    • SWISS-MODEL for homology modeling if suitable templates exist

  • Functional annotation:

    • Gene Ontology (GO) term enrichment analysis

    • Protein-protein interaction prediction using STRING

    • Conserved motif identification using MEME suite

  • Evolutionary analysis:

    • Construct phylogenetic trees with homologous proteins

    • Identify conserved residues across related species

    • Calculate selective pressure (dN/dS) to identify functionally important regions

For Pcryo_1498 specifically, the membrane localization suggests you should emphasize tools optimized for membrane proteins and consider the psychrophilic origin of Psychrobacter cryohalolentis when interpreting results.

How can researchers effectively design experiments to determine the membrane topology of Pcryo_1498?

Determining membrane topology is crucial for understanding Pcryo_1498 function. A comprehensive experimental approach includes:

Methodological Approach to Topology Mapping:

  • Cysteine scanning mutagenesis:

    • Systematically replace individual amino acids with cysteine residues

    • Treat with membrane-impermeable sulfhydryl reagents

    • Accessibility patterns reveal membrane orientation

  • Fusion protein method:

    • Create fusion proteins with reporter domains (e.g., GFP, alkaline phosphatase)

    • Expression patterns of the fusion constructs indicate topology

    • Design multiple constructs with reporters at different positions

  • Protease protection assay:

    • Express the protein in membrane vesicles

    • Treat with proteases under controlled conditions

    • Analyze fragments by mass spectrometry or Western blotting

    • Protected regions are typically embedded in the membrane

  • Epitope tagging:

    • Insert small epitope tags at predicted loop regions

    • Use immunofluorescence or flow cytometry with specific antibodies

    • Differential labeling in permeabilized/non-permeabilized cells reveals topology

A robust experimental design should combine at least two of these approaches for cross-validation. For each method, include appropriate controls and ensure sufficient replication to account for experimental variability.

What are effective strategies for investigating potential interaction partners of Pcryo_1498 in membrane environments?

Investigating protein-protein interactions for membrane proteins requires specialized approaches:

Methodological Framework for Interaction Studies:

  • Co-immunoprecipitation with membrane solubilization:

    • Solubilize membranes with mild detergents (e.g., digitonin, DDM)

    • Use anti-His antibodies to pull down His-tagged Pcryo_1498

    • Identify co-precipitating proteins by mass spectrometry

    • Validate interactions with reciprocal pull-downs

  • Proximity labeling approaches:

    • Generate fusion proteins with BioID or APEX2

    • Express in appropriate host cells

    • Identify biotinylated proximity partners

    • Quantitative comparison with control conditions

  • Membrane-based yeast two-hybrid (MYTH):

    • Clone Pcryo_1498 into bait vectors

    • Screen against prey libraries derived from Psychrobacter or related bacteria

    • Validate positive interactions with secondary assays

  • Crosslinking mass spectrometry:

    • Treat reconstituted Pcryo_1498 with crosslinkers of varying spacer lengths

    • Digest and analyze by LC-MS/MS

    • Map crosslinked residues to identify interface regions

A comprehensive interaction study should include negative controls (unrelated membrane proteins) and positive controls if known interaction partners exist. The experimental design should also account for the native lipid environment, as membrane composition can significantly influence protein-protein interactions.

How can researchers effectively characterize the role of Pcryo_1498 in cold adaptation mechanisms?

Given that Psychrobacter cryohalolentis is a psychrophilic organism, investigating the role of Pcryo_1498 in cold adaptation requires specialized experimental approaches:

Cold Adaptation Research Strategy:

  • Comparative expression analysis:

    • Culture Psychrobacter cryohalolentis at various temperatures (0°C, 4°C, 15°C, 22°C)

    • Quantify Pcryo_1498 expression using RT-qPCR and Western blotting

    • Correlate expression levels with growth rates and membrane fluidity measurements

  • Gene knockout/complementation studies:

    • Generate Pcryo_1498 deletion mutants

    • Assess growth phenotypes at different temperatures

    • Complement with wild-type and mutant variants

    • Measure membrane integrity and fluidity parameters

  • Heterologous expression assessment:

    • Express Pcryo_1498 in mesophilic bacterial hosts

    • Evaluate changes in cold tolerance

    • Measure membrane physical properties

  • Structural dynamics analysis:

    • Perform molecular dynamics simulations at various temperatures

    • Compare flexibility parameters with mesophilic homologs

    • Identify regions with temperature-dependent conformational changes

The table below summarizes typical parameters for cold adaptation studies:

ParameterPsychrophilic conditionMesophilic conditionMeasurement technique
Growth rate0-15°C20-37°COptical density monitoring
Membrane fluidityHigher at low tempsLower at low tempsFluorescence anisotropy
Protein mobilityEnhancedRestrictedFRAP microscopy
Lipid compositionIncreased unsaturated fatty acidsMore saturated fatty acidsLipidomics analysis

Experimental design should include appropriate controls and sufficient replication to account for variability in membrane-associated parameters.

What are the common challenges in purifying recombinant Pcryo_1498 and how can they be addressed?

Membrane protein purification presents unique challenges. Here's a methodological approach to addressing common issues with Pcryo_1498:

Problem-Solving Methodology for Purification:

  • Low expression levels:

    • Optimize codon usage for E. coli

    • Test different expression strains (BL21(DE3), C41(DE3), C43(DE3))

    • Evaluate lower induction temperatures (16-20°C)

    • Try expression enhancers like DMSO or ethanol in the culture medium

  • Protein aggregation:

    • Screen multiple detergents (DDM, LDAO, Fos-choline, LMNG)

    • Include stabilizing agents (glycerol, specific lipids, cholesteryl hemisuccinate)

    • Optimize buffer conditions (pH, salt concentration)

    • Consider fusion with solubility-enhancing tags (MBP, SUMO)

  • Poor solubilization:

    • Increase detergent:protein ratio

    • Test longer solubilization times

    • Evaluate solubilization at different temperatures

    • Consider mixed detergent systems

  • Low purity:

    • Implement two-step purification (IMAC followed by size exclusion)

    • Add imidazole wash steps to reduce non-specific binding

    • Consider ion exchange chromatography as an additional step

    • Optimize salt concentration in wash buffers

Purification Troubleshooting Decision Tree:

For persistent purification issues, follow this decision-making process:

  • Verify expression by Western blot before attempting purification

  • If expressed but insoluble, focus on solubilization conditions

  • If solubilized but poor binding to resin, check tag accessibility

  • If binding but co-purifying with contaminants, optimize wash conditions

  • If aggregating during concentration, evaluate detergent exchange or protein stabilizers

What experimental design considerations are essential for investigating the function of Pcryo_1498 when contradictory results emerge?

When faced with contradictory results in Pcryo_1498 functional studies, a systematic approach to experimental design is crucial:

Conflict Resolution Methodology:

  • Standardize experimental conditions:

    • Establish a unified protocol for protein preparation

    • Define consistent buffer compositions and pH conditions

    • Control for variations in temperature and incubation times

    • Use the same detergent/lipid systems across experiments

  • Implement robust controls:

    • Include both positive and negative controls

    • Use multiple independent protein preparations

    • Incorporate internal technical controls for each assay

    • Consider tagged and untagged protein versions to rule out tag effects

  • Cross-validate with orthogonal techniques:

    • For binding studies, use at least two different binding assay formats

    • For structural analyses, combine spectroscopic and biochemical approaches

    • For functional studies, assess activity under varying conditions

    • Consider both in vitro and in vivo approaches when possible

  • Statistical considerations:

    • Increase the number of biological and technical replicates

    • Perform power analysis to determine adequate sample sizes

    • Use appropriate statistical tests for data analysis

    • Consider blinded experimental design when possible

When designing experiments to resolve contradictions, it's essential to identify the specific variables that might account for the disparate results. Systematically testing these variables through factorial experimental designs can help identify interaction effects that might explain previous contradictory outcomes .

How can researchers formulate strong research questions about Pcryo_1498 that advance the field?

Developing effective research questions about Pcryo_1498 requires strategic thinking and awareness of the current knowledge gaps:

Research Question Development Framework:

  • Preliminary assessment:

    • Conduct thorough literature review on UPF0060 family proteins

    • Identify knowledge gaps regarding membrane proteins in psychrophilic organisms

    • Evaluate the current state of understanding about Pcryo_1498

  • Question formulation techniques:

    • Focus questions on a single problem or issue

    • Ensure questions are researchable using available techniques

    • Develop questions that are feasible within practical constraints

    • Create questions specific enough to answer thoroughly yet complex enough for meaningful investigation

  • Question evaluation criteria:

    • Focused and researchable using credible methodologies

    • Feasible within practical constraints of membrane protein research

    • Uses specific, well-defined concepts

    • Complex and arguable (cannot be answered with yes/no or simple facts)

    • Relevant to current scientific debates in membrane biology or psychrophilic adaptation

Examples of Strong Research Questions for Pcryo_1498:

Research categoryExample research questionMethodological approach
Structure-functionHow do the transmembrane domains of Pcryo_1498 contribute to its stability at low temperatures?Site-directed mutagenesis combined with thermal stability assays
Evolutionary biologyWhat selective pressures have shaped the evolution of UPF0060 proteins in psychrophilic bacteria compared to mesophilic relatives?Comparative genomics and molecular evolution analyses
Systems biologyHow does the expression of Pcryo_1498 integrate with other cold-response mechanisms in Psychrobacter cryohalolentis?Transcriptomics and proteomics under various temperature conditions

Developing questions that connect Pcryo_1498 to broader biological themes will help position your research for greater impact and relevance in the field .

What are advanced approaches to investigating membrane protein dynamics of Pcryo_1498 in different environmental conditions?

Investigating membrane protein dynamics requires sophisticated methodological approaches, particularly for proteins like Pcryo_1498 that may function under extreme conditions:

Advanced Dynamics Investigation Protocol:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Expose reconstituted Pcryo_1498 to D₂O buffer at different temperatures

    • Quench at various time points and digest with pepsin

    • Analyze deuterium incorporation by LC-MS

    • Map flexibility and solvent accessibility changes across temperatures

  • Molecular dynamics simulations:

    • Construct membrane-embedded models of Pcryo_1498

    • Simulate behavior at various temperatures (0°C, 10°C, 20°C, 30°C)

    • Analyze conformational dynamics and lipid interactions

    • Compare flexibility metrics with experimental data

  • Site-directed spin labeling with EPR spectroscopy:

    • Introduce cysteine residues at strategic positions

    • Label with nitroxide spin labels

    • Measure mobility parameters at different temperatures

    • Determine conformational changes in response to environmental shifts

  • Single-molecule FRET studies:

    • Engineer Pcryo_1498 with fluorophore pairs at key positions

    • Reconstitute into model membranes or nanodiscs

    • Monitor distance changes under varying conditions

    • Correlate structural dynamics with functional states

For psychrophilic membrane proteins like Pcryo_1498, it's particularly important to design experiments that can be conducted at low temperatures without compromising measurement sensitivity. Specialized equipment modifications may be necessary for techniques like EPR or single-molecule studies at temperatures below 10°C.

The experimental design should incorporate factorial approaches that systematically vary temperature, pH, membrane composition, and ionic strength to identify interaction effects between these variables that might reveal adaptation mechanisms specific to psychrophilic environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.