Recombinant Psychrobacter sp. Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Proteolytic Activity

  • Substrate Specificity: Recombinant HtpX cleaves misfolded membrane and soluble proteins, analogous to its homolog in Escherichia coli .

  • Zinc Dependency: Activity is abolished in the absence of Zn²⁺, confirming its metalloprotease classification .

  • Stress Response: Upregulated under heat shock or oxidative stress, suggesting a role in cellular stress adaptation .

Industrial Relevance

  • Cold-Chain Storage: Retains activity at low temperatures, ideal for dairy and meat preservation .

  • Bioremediation: Degrades organic pollutants in cold environments due to psychrophilic activity .

  • Probiotic Development: Non-pathogenic Psychrobacter strains expressing HtpX show potential in food biofortification .

Antimicrobial Research

  • Drug Target: Highly conserved HtpX in pathogens like Neisseria gonorrhoeae is explored for antibiotic adjuvants .

  • Inhibitor Screening: Small molecules like pemirolast bind HtpX’s zinc domain, reducing bacterial viability .

Research Challenges

  • Expression Optimization: Low yields in E. coli due to self-degradation; refolding protocols with zinc chelators improve stability .

  • Structural Complexity: Membrane integration complicates crystallization, necessitating detergent solubilization for in vitro studies .

Future Directions

  • CRISPR-Cas Integration: Leverage Psychrobacter’s endogenous CRISPR system for strain engineering .

  • High-Throughput Assays: Develop fluorescence-based substrates for real-time activity monitoring .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, kindly indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Important: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note: The tag type is determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
htpX; PsycPRwf_2215; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Psychrobacter sp. (strain PRwf-1)
Target Names
htpX
Target Protein Sequence
MMRIGLFLLTNLAVLVVFSIVFGILSSVFGLGSVHGAGGLNIASLAVMCAVYGMIGSMIS LFLSKWMAKRSTGTVVIEQPRNASEQWLVETVAKQAKAVNIDMPEVGIFDNAQPNAFATG WNKNKALVAVSSGLLHTMTPDEVEAVLAHEIGHVANGDMVTLALIQGVVNAFVMFFARIV GSFVDRVVFKNEDGPGIGYFVTSIVMDILLGFLASAIVMWFSRQREFRADAMGAKLAGRD KMISALNALRPAEARPDQMPENMQAFAISSGQTQGFSIANFFRSHPTLDDRIEALKKYTP GQS
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is HtpX protease and what is its role in bacterial cells?

HtpX is a membrane-bound zinc metalloproteinase belonging to the M48 family of proteases. It plays a critical role in the quality control of membrane proteins by eliminating malfolded and/or misassembled membrane proteins that could disrupt membrane structure and function. HtpX is involved in proteolytic quality control of cytoplasmic membrane proteins, which is essential for maintaining normal cellular activities . Unlike cytoplasmic proteases, HtpX is specifically localized to the membrane, making it specialized for degrading membrane-associated protein substrates. The protease contributes significantly to bacterial stress responses, particularly under conditions that cause protein misfolding or damage.

How does the structure of HtpX relate to its function in Psychrobacter species?

HtpX in Psychrobacter species, similar to its homolog in E. coli, is an integral membrane protein featuring multiple transmembrane segments. E. coli HtpX has four hydrophobic regions (H1-H4) that could function as transmembrane segments, although there is controversy regarding whether the two C-terminal regions are actually embedded in the membrane . The catalytic domain of HtpX contains a zinc-binding motif characteristic of M48 metalloproteases, which is essential for its proteolytic activity. In Psychrobacter species, which are psychrophilic (cold-adapted) bacteria, the HtpX protease likely has structural adaptations that allow it to function optimally at lower temperatures, distinguishing it from mesophilic homologs. These adaptations may include increased flexibility in certain regions and modifications to substrate-binding sites to maintain catalytic efficiency in cold environments.

What experimental systems exist for studying HtpX activity?

Researchers have developed several experimental approaches to study HtpX activity:

  • In vivo protease activity assays: A semiquantitative and convenient system has been established using model substrates specifically designed for HtpX. One such system uses a constructed model substrate called XMS1 (HtpX Model Substrate 1) that allows for detection of differential protease activities of HtpX variants .

  • Gene deletion studies: Creating individual or combined in-frame deletions of protease genes, including htpX, and assessing the impact on bacterial phenotypes such as antibiotic resistance. This approach has been used to demonstrate the role of HtpX in aminoglycoside resistance in bacteria like Stenotrophomonas maltophilia .

  • Complementation experiments: Reintroducing wild-type copies of deleted genes to confirm phenotypic effects. For example, plasmid-based expression of htpX has been used to restore aminoglycoside resistance in htpX-deficient strains .

  • Expression systems: Various expression vectors and host systems have been developed for producing recombinant HtpX for in vitro studies, including systems that add tags (such as His6-Myc or His10) to facilitate purification and detection .

How does recombinant expression affect the structure and function of Psychrobacter sp. HtpX?

Recombinant expression of membrane proteases like HtpX presents several challenges that can impact structure and function. When expressing Psychrobacter sp. HtpX recombinantly, researchers should consider:

  • Membrane integration: Proper insertion of HtpX into host cell membranes is crucial for maintaining its native conformation and activity. Expression systems must support correct membrane targeting and folding.

  • Post-translational modifications: Any species-specific modifications present in native Psychrobacter HtpX may be absent in heterologous expression systems, potentially affecting activity.

  • Affinity tags: The addition of purification tags (His, Myc, etc.) can sometimes interfere with protease activity or substrate recognition, necessitating careful tag design and placement. Systems using HtpX-His6-Myc (HtpX-HM) or HtpX-His10 (HtpX-H10) have been developed for other bacterial HtpX proteins and might be adaptable for Psychrobacter sp. HtpX .

  • Expression temperature: Since Psychrobacter is psychrophilic, recombinant expression at standard laboratory temperatures (37°C) might yield enzyme with altered properties compared to its native state. Lower expression temperatures may better preserve the natural characteristics of the enzyme.

  • Detergent solubilization: Extraction of recombinant HtpX from membranes requires detergents that can potentially affect protein structure and activity, requiring optimization to maintain functional integrity.

What is the role of HtpX in antimicrobial resistance in Psychrobacter species?

Research on related bacterial species suggests that HtpX may contribute to antimicrobial resistance in Psychrobacter:

  • Aminoglycoside resistance: In Stenotrophomonas maltophilia, HtpX has been identified as a primary determinant responsible for intrinsic aminoglycoside resistance. Inactivation of htpX in S. maltophilia significantly increased susceptibility to aminoglycosides (2- to 16-fold reduction in MICs) . Similar mechanisms might operate in Psychrobacter species.

  • Membrane protein quality control: By contributing to membrane homeostasis through the elimination of damaged membrane proteins, HtpX likely helps maintain membrane integrity during antibiotic stress. This general protective effect could contribute to resistance against membrane-active antibiotics.

  • Potential interaction with efflux systems: In S. maltophilia, inactivation of htpX compromised SmeYZ pump-mediated aminoglycoside resistance , suggesting proteases like HtpX may work in concert with efflux systems. Similar protease-efflux pump interactions might exist in Psychrobacter.

  • Protein misfolding response: Antibiotics that cause protein misfolding or accumulation of aberrant proteins might trigger increased htpX expression as part of the stress response. This upregulation could contribute to adaptive resistance.

Based on observations in S. maltophilia, HtpX could be considered a potential aminoglycoside adjuvant target for treatment of Psychrobacter infections, although specific studies on Psychrobacter sp. HtpX and antibiotic resistance are needed to confirm this role.

How can researchers develop effective model substrates for studying Psychrobacter sp. HtpX specificity?

Developing model substrates for studying HtpX requires understanding its substrate recognition patterns and establishing systems that allow for sensitive detection of proteolytic activity. Based on approaches used for E. coli HtpX , researchers studying Psychrobacter sp. HtpX could consider:

  • Fusion protein design: Creating chimeric proteins containing potential HtpX cleavage sites flanked by domains that facilitate detection (e.g., fluorescent proteins, epitope tags). The model substrate XMS1 designed for E. coli HtpX represents a successful example of this approach .

  • Incorporation of membrane segments: Since HtpX targets membrane proteins, effective model substrates should include transmembrane segments that mimic natural substrates.

  • Reporter systems: Incorporating reporters such as GFP (green fluorescent protein) or msfGFP (monomeric superfolder GFP) that undergo detectable changes upon substrate cleavage. This allows for monitoring protease activity in real-time or in high-throughput formats .

  • Protease-specific cleavage sites: Identifying and incorporating sequence motifs recognized by Psychrobacter HtpX, perhaps based on homology to known HtpX substrates from other species but adapted to account for the unique specificity of the Psychrobacter enzyme.

  • Detection methods: Establishing complementary detection methods, such as western blotting with antibodies against N-terminal and C-terminal tags to identify cleavage products (e.g., CL-N and CL-C fragments) .

These approaches would enable researchers to establish a semiquantitative assay system for Psychrobacter sp. HtpX, similar to what has been accomplished for E. coli HtpX, facilitating detailed characterization of its activity and specificity.

What is known about the catalytic mechanism of HtpX and potential inhibitors?

HtpX belongs to the M48 family of zinc metalloproteinases, which employ a metal-dependent hydrolysis mechanism for peptide bond cleavage. Key aspects of its catalytic mechanism include:

  • Zinc coordination: The active site contains a zinc ion coordinated by conserved histidine and glutamate residues, forming the catalytic center typical of metalloproteases.

  • Conserved motifs: M48 family proteases contain the HEXXH motif, where the two histidines coordinate the zinc ion and the glutamate activates a water molecule for nucleophilic attack on the peptide bond.

  • Substrate binding: The protease likely contains substrate-binding pockets that determine specificity through interactions with amino acid side chains flanking the cleavage site.

  • Membrane context: The catalytic site of HtpX is positioned relative to the membrane in a way that allows access to specific regions of membrane protein substrates, such as misfolded domains or degradation signals exposed during stress.

Regarding inhibitors, while specific inhibitors of Psychrobacter sp. HtpX have not been described in the provided search results, general metalloprotease inhibitors such as EDTA (which chelates the catalytic zinc) and peptide-based inhibitors designed to mimic substrate binding might be effective. The identification of HtpX as a contributor to aminoglycoside resistance in some bacteria suggests that specific HtpX inhibitors could potentially serve as antibiotic adjuvants, enhancing the efficacy of aminoglycosides against resistant bacteria .

What expression systems are most suitable for producing recombinant Psychrobacter sp. HtpX?

Based on general principles of membrane protein expression and specific information about HtpX from the search results, the following expression systems could be considered for Psychrobacter sp. HtpX:

  • E. coli-based systems: Despite challenges in expressing psychrophilic proteins, adapted E. coli strains with modified growth conditions (lower temperature, specialized media) can be effective for expressing Psychrobacter proteins. Common E. coli strains used for membrane protein expression include C41(DE3) and C43(DE3), which are better tolerate membrane protein overexpression.

  • Cold-adapted expression hosts: Using alternative hosts like Pseudoalteromonas haloplanktis or other psychrophilic bacteria might provide a more native-like environment for Psychrobacter protein expression.

  • Expression vectors: Vectors with tunable promoters (e.g., arabinose-inducible pBAD, IPTG-inducible pET with lower inducer concentrations) allow control over expression levels to prevent toxicity associated with membrane protein overexpression.

  • Fusion partners: Addition of fusion partners that enhance membrane targeting and folding can improve expression yields. Common fusion partners include Mistic, GFP (which also serves as a folding indicator), or SUMO tags.

  • Purification strategies: Incorporating affinity tags like His6, His10, or Strep-tag II facilitates purification, as demonstrated with HtpX-His6-Myc (HtpX-HM) and HtpX-His10 constructs used for E. coli HtpX .

  • Membrane extraction: Optimization of detergent types and concentrations for membrane extraction is crucial for obtaining functional protease. Mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin are often suitable for maintaining membrane protein activity.

The selection of an appropriate expression system should consider the specific research goals, whether structural studies requiring high yields of purified protein or functional assays that might be performed in whole cells or membrane fractions.

How can researchers accurately measure HtpX activity in experimental settings?

Several approaches can be employed to measure HtpX protease activity with different levels of sensitivity and applicability:

  • In vivo model substrate assays: The approach described for E. coli HtpX using the XMS1 substrate represents a semiquantitative and convenient system for assessing protease activity . This involves:

    • Expression of a model substrate containing HtpX cleavage sites

    • Detection of cleaved products using techniques like western blotting

    • Quantification of the ratio between full-length substrate and cleaved products

  • Phenotypic assays: For Psychrobacter sp. HtpX, measuring changes in antibiotic susceptibility (particularly to aminoglycosides) in wild-type versus htpX deletion mutants can provide indirect evidence of protease activity, similar to approaches used for S. maltophilia . This would involve:

    • Construction of htpX deletion mutants

    • Determination of minimum inhibitory concentrations (MICs) for various antibiotics

    • Complementation with wild-type htpX to confirm phenotype specificity

  • Fluorogenic substrate assays: Development of synthetic peptide substrates containing fluorophore-quencher pairs that increase fluorescence upon cleavage.

  • Proteomics approaches: Mass spectrometry-based analyses to identify HtpX-dependent changes in the membrane proteome, revealing potential natural substrates and cleavage sites.

  • Microscopy techniques: Fluorescence microscopy to visualize the degradation of tagged membrane proteins in the presence or absence of functional HtpX.

Table 1: Comparison of Methods for Measuring HtpX Activity

MethodAdvantagesLimitationsApplication
In vivo model substrate assaysReflects physiological conditions; Allows for mutant analysisSemi-quantitative; Requires western blottingCharacterization of HtpX variants; Inhibitor screening
Antibiotic susceptibility testingProvides functional relevance; Simple methodologyIndirect measure of activity; Potential confounding factorsAssessment of HtpX role in antibiotic resistance
Fluorogenic substrate assaysQuantitative; High-throughput potentialMay not reflect natural substrate specificityKinetic studies; Inhibitor screening
ProteomicsIdentifies natural substrates; Provides cleavage site informationComplex data analysis; Requires specialized equipmentSubstrate discovery; Mechanism studies
Fluorescence microscopyVisualizes activity in cellular contextQualitative; Requires specialized equipmentLocalization studies; In vivo activity assessment

What strategies can be employed to identify physiological substrates of Psychrobacter sp. HtpX?

Identifying the natural substrates of HtpX is challenging but essential for understanding its physiological functions. Several complementary approaches can be employed:

  • Comparative proteomics: Compare the membrane proteome profiles of wild-type and htpX-deficient Psychrobacter strains to identify proteins that accumulate in the absence of HtpX. This approach can be enhanced by applying stress conditions (e.g., heat shock, antibiotic exposure) that might increase the requirement for HtpX-mediated proteolysis.

  • Substrate trapping: Generate catalytically inactive HtpX variants (by mutating the active site) that can bind but not cleave substrates, followed by co-immunoprecipitation and mass spectrometry to identify trapped substrate proteins.

  • Terminal amine isotopic labeling of substrates (TAILS): This N-terminomics approach can identify protease-generated protein fragments by comparing peptide profiles between conditions with and without active HtpX.

  • Bioinformatic prediction: Analyze the Psychrobacter proteome for membrane proteins with features similar to known HtpX substrates from other bacteria, focusing on proteins involved in stress response or antibiotic resistance mechanisms.

  • Genetic interaction screening: Identify genetic interactions between htpX and other genes involved in membrane protein quality control to elucidate functional pathways and potential substrate overlap.

  • Heterologous expression: Express candidate Psychrobacter membrane proteins in a system with controllable HtpX expression to directly test substrate-protease relationships.

These approaches, particularly when used in combination, can provide a comprehensive view of the physiological substrate spectrum of Psychrobacter sp. HtpX and insight into its specific functions in this psychrophilic bacterium.

How can mutagenesis studies help elucidate functional domains in HtpX?

Site-directed mutagenesis provides a powerful approach for investigating structure-function relationships in HtpX. Based on the established in vivo protease activity assay for E. coli HtpX , similar strategies could be applied to Psychrobacter sp. HtpX:

  • Catalytic site mutations: Mutations in the conserved HEXXH motif that coordinates the catalytic zinc ion would be expected to abolish proteolytic activity. These mutants can serve as negative controls in activity assays and for substrate-trapping experiments.

  • Transmembrane domain modifications: Alterations to the transmembrane segments could reveal their role in membrane integration, substrate recognition, or activity regulation. Systematic chimeras with transmembrane domains from other proteases might identify regions critical for Psychrobacter-specific functions.

  • Psychrophilic adaptation sites: Comparing sequences of Psychrobacter HtpX with mesophilic homologs can identify residues potentially involved in cold adaptation. Mutating these residues to their mesophilic counterparts and assessing activity at different temperatures could reveal mechanisms of temperature adaptation.

  • Substrate binding site mutations: Modifying residues predicted to be involved in substrate binding based on homology models or experimental data can help map the substrate-binding interface and determinants of specificity.

  • Regulatory domain alterations: Mutations in potential regulatory regions might affect HtpX activation or response to stress conditions.

The effectiveness of this approach depends on establishing reliable expression and activity assays for Psychrobacter sp. HtpX, similar to the model substrate system developed for E. coli HtpX. This would enable detection of differential protease activities among HtpX mutants carrying mutations in conserved regions .

What is the potential role of HtpX in Psychrobacter infections?

While the specific role of HtpX in Psychrobacter infections has not been directly investigated according to the provided search results, several inferences can be made based on information about Psychrobacter infections and HtpX functions in other bacteria:

  • Aminoglycoside resistance: Given that HtpX contributes to aminoglycoside resistance in bacteria like S. maltophilia , it might play a similar role in clinical Psychrobacter isolates. This is particularly relevant since aminoglycosides are among the antibiotics used to treat Psychrobacter infections.

  • Survival under stress conditions: HtpX's role in protein quality control likely contributes to bacterial survival under the stress conditions encountered during infection, including temperature shifts, immune responses, and antibiotic exposure.

  • Virulence factor regulation: By maintaining membrane protein homeostasis, HtpX might indirectly affect the expression or function of virulence factors. Psychrobacter species possess several virulence genes, including those involved in antimicrobial resistance, cell invasion, type IV secretion system, and iron uptake .

  • Persistence in clinical settings: Psychrobacter infections, while uncommon, are increasingly identified, particularly in immunocompromised individuals . Proteins involved in stress responses, like HtpX, may contribute to persistence in clinical environments.

  • Potential therapeutic target: Given HtpX's role in aminoglycoside resistance in some bacteria, it could represent a therapeutic target for enhancing antibiotic efficacy against Psychrobacter infections, which have shown a high mortality rate (44.4%), especially in cases of bacteremia (50%) .

Further research specifically examining htpX expression during Psychrobacter infection models and the impact of htpX deletion on virulence and antibiotic resistance would be necessary to confirm these potential roles.

How does the psychrophilic nature of Psychrobacter sp. affect HtpX function and applications?

Psychrobacter species are psychrophilic bacteria adapted to cold environments, which likely influences the structure, function, and potential applications of their enzymes, including HtpX:

  • Cold adaptation mechanisms: Psychrophilic enzymes typically exhibit higher catalytic efficiency at low temperatures compared to mesophilic homologs, achieved through structural modifications that increase flexibility and reduce stability at higher temperatures. Psychrobacter HtpX likely possesses such adaptations, which could include:

    • Reduced number of salt bridges and hydrogen bonds

    • Increased proportion of glycine residues

    • Modified surface charge distribution

    • Decreased hydrophobic core packing

  • Temperature-dependent activity profile: The activity of Psychrobacter HtpX is likely optimized for lower temperatures (0-20°C) compared to mesophilic homologs (which typically function optimally at 37°C). This could make it useful for biotechnological applications requiring proteolytic activity at low temperatures.

  • Substrate specificity adaptations: The substrate recognition sites in Psychrobacter HtpX may be adapted to interact with membrane proteins that also possess cold-adapted features, potentially resulting in different specificity compared to mesophilic homologs.

  • Expression and stability considerations: When expressing recombinant Psychrobacter HtpX, temperature conditions must be carefully controlled, as expression at temperatures too high for the enzyme's stability might result in misfolding or aggregation.

  • Potential biotechnological applications: Cold-active proteases like Psychrobacter HtpX could have applications in:

    • Low-temperature bioprocessing

    • Bioremediation in cold environments

    • Food processing at refrigeration temperatures

    • Development of cold-wash detergents

Understanding these cold-adaptation features would require comparative studies between Psychrobacter HtpX and its mesophilic homologs, examining structure, stability, and activity across temperature ranges.

What are the most promising research directions for Psychrobacter sp. HtpX?

Based on the available information and current gaps in knowledge, several promising research directions for Psychrobacter sp. HtpX can be identified:

  • Structural characterization: Determining the three-dimensional structure of Psychrobacter HtpX would provide valuable insights into its cold-adaptation mechanisms and substrate recognition features. Cryo-electron microscopy might be particularly suitable given the membrane-bound nature of the protease.

  • Substrate identification: Comprehensive identification of physiological substrates would illuminate HtpX's specific roles in Psychrobacter physiology and potentially in virulence or antibiotic resistance.

  • Temperature adaptation mechanisms: Comparative studies of Psychrobacter HtpX with mesophilic homologs across temperature ranges would reveal adaptations that enable function in cold environments and could inspire biotechnological applications.

  • Inhibitor development: Based on findings that HtpX contributes to aminoglycoside resistance in some bacteria , developing specific inhibitors of Psychrobacter HtpX could lead to adjuvants that enhance antibiotic efficacy against Psychrobacter infections.

  • Clinical relevance: Investigating the expression and role of HtpX in clinical Psychrobacter isolates, particularly in relation to antibiotic resistance and virulence, could provide insights relevant to treating Psychrobacter infections, which have shown significant mortality rates .

  • Model substrate development: Adapting approaches used for E. coli HtpX to develop model substrates specific for Psychrobacter HtpX would facilitate detailed characterization of its activity, specificity, and regulation.

  • Biotechnological applications: Exploring potential applications of this cold-adapted protease in industrial or biotechnological processes that require proteolytic activity at low temperatures.

These research directions would contribute to a more comprehensive understanding of Psychrobacter sp. HtpX and potentially lead to applications in both medical and biotechnological fields.

What technical challenges remain in studying Psychrobacter sp. HtpX and how might they be addressed?

Several technical challenges complicate the study of Psychrobacter sp. HtpX, each requiring specific strategies to overcome:

  • Expression of functional recombinant protein: As a membrane-bound protease from a psychrophilic organism, Psychrobacter HtpX presents challenges for recombinant expression. Potential solutions include:

    • Using cold-adapted expression hosts

    • Employing specialized membrane protein expression systems

    • Optimizing expression conditions (temperature, induction level, media composition)

    • Developing fusion constructs that enhance folding and membrane integration

  • Activity assay development: Establishing reliable, quantitative assays for Psychrobacter HtpX activity is essential. Approaches might include:

    • Adapting the model substrate approach used for E. coli HtpX

    • Developing fluorogenic or chromogenic substrates specific to Psychrobacter HtpX

    • Creating reporter systems for monitoring activity in vivo

  • Genetic manipulation of Psychrobacter: Developing efficient genetic tools for Psychrobacter species would facilitate in vivo studies of HtpX function. This might involve:

    • Optimizing transformation protocols for Psychrobacter

    • Developing targeted gene deletion and complementation systems

    • Establishing inducible expression systems compatible with psychrophilic growth

  • Structural studies: The membrane-bound nature of HtpX complicates structural determination. Potential approaches include:

    • Cryo-electron microscopy of HtpX in nanodiscs or amphipols

    • X-ray crystallography of solubilized domains or stabilized full-length protein

    • Computational modeling based on homologous structures

  • Physiological substrate identification: Identifying natural HtpX substrates in Psychrobacter is challenging but crucial. Strategies might include:

    • Comparative proteomics of wild-type and htpX-deficient strains

    • Substrate-trapping approaches using catalytically inactive HtpX variants

    • Targeted analysis of candidate substrates based on homology to known substrates in other species

  • Temperature-sensitive experimental design: Working with psychrophilic enzymes requires careful control of temperature throughout experimental procedures. Solutions include:

    • Temperature-controlled equipment for all stages of protein preparation and analysis

    • Rapid processing to minimize exposure to inactivating temperatures

    • Inclusion of stabilizing additives when higher temperatures cannot be avoided

Addressing these technical challenges will require interdisciplinary approaches combining molecular biology, protein biochemistry, structural biology, and microbiology techniques adapted for work with psychrophilic organisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.