Recombinant Psychromonas ingrahamii ATP synthase subunit a (atpB)

What is the primary structure of Psychromonas ingrahamii ATP synthase subunit a (atpB)?

Psychromonas ingrahamii ATP synthase subunit a (atpB) is a full-length protein comprising 267 amino acids. The complete amino acid sequence is: MLTSSGYIQHHLTNAQMCTVDGSIAFNYACADAGFWTWHIDSLLFSVGLGVLFLFVFYKVGQKATTGVPGKLQCAVEMLMEFVSNAVKDSFHGRSPVIAPLALTIFVWILLMNTMDLIPVDFIPEAAKQILGVPYLKVVPTTDMNITFGLSLSVFALIVFYSIKIKGITGFVKELTLQPFNHWAFIPVNFILETIALIAKPISLSLRLFGNLYAGELIFILIALMPWWSQAALSVPWAIFHILVIVLQAFIFMMLTIVYLSMAHEDH . This sequence information is critical for designing site-directed mutagenesis experiments and structural studies on this psychrophilic ATP synthase component.

What are the recommended storage and handling conditions for recombinant P. ingrahamii atpB?

Recombinant P. ingrahamii atpB protein requires specific handling protocols to maintain stability and activity. The lyophilized protein should be stored at -20°C to -80°C upon receipt, with aliquoting necessary for multiple use scenarios. Upon reconstitution, it should be prepared in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol (final concentration) added as a cryoprotectant . Repeated freeze-thaw cycles should be strictly avoided to prevent protein degradation and activity loss. For short-term work, working aliquots can be stored at 4°C for up to one week . These handling precautions are especially important for psychrophilic proteins that may exhibit decreased stability at room temperature compared to mesophilic counterparts.

How does the P. ingrahamii ATP synthase function at extremely low temperatures?

P. ingrahamii ATP synthase maintains functionality at temperatures as low as -12°C through specialized adaptations in both protein structure and cellular physiology. The ATP synthase complex likely possesses increased flexibility in catalytic and regulatory domains to maintain conformational changes necessary for the rotary mechanism at low temperatures . Additionally, P. ingrahamii employs supporting mechanisms such as production of extracellular polysaccharides (mediated by its extensive set of 61 regulators of cyclic GDP) that may help sequester water or lower the freezing point around the cell . The bacterium also produces osmolytes like betaine choline to balance osmotic pressure in freezing environments, which indirectly supports membrane protein function including ATP synthase . Genomic analysis suggests unique protein clusters that may contain cold-specific proteins supporting ATP synthase function at extreme temperatures.

What is the role of protonmotive force in P. ingrahamii ATP synthase function in psychrophilic conditions?

ATP synthesis by P. ingrahamii ATP synthase is energized by the protonmotive force (pmf) across the cell membrane, following the general mechanism: ADP + Pi + nH+P-side ⇌ ATP + H2O + nH+N-side . At extremely low temperatures, maintaining sufficient pmf presents a significant challenge due to reduced membrane fluidity and potentially altered proton translocation pathways. Unlike alkaliphiles that face challenges due to adverse pH gradients, psychrophiles like P. ingrahamii must overcome kinetic limitations imposed by low temperatures . The a-subunit (atpB) plays a critical role in this process by providing the proton path from outside the membrane surface to the carboxylates of interacting c-subunits of the rotor, with an essential arginine residue in transmembrane helix 4 (TMH4) facilitating proton transfer within the membrane environment . Current evidence suggests P. ingrahamii employs H+-coupled (rather than Na+-coupled) ATP synthesis, even under extreme conditions.

How does the a-subunit (atpB) interact with other ATP synthase components in the cold-adapted rotary mechanism?

In the P. ingrahamii ATP synthase complex, the a-subunit (atpB) forms a critical interface with the c-ring to facilitate ion translocation during the rotary mechanism. The a-subunit contains transmembrane helices that create half-channels for proton entry from the periplasm to the c-subunit binding sites and exit into the cytoplasm . The essential arginine residue in TMH4 of the a-subunit interacts with c-subunit carboxylates, facilitating proton release from c-subunits completing rotation and creating an environment for re-protonation . This a-c subunit interface generates torque that drives rotation of the central stalk (γ and ε subunits), which in turn induces conformational changes in the F1 catalytic head to enable ATP synthesis . In psychrophilic conditions, these protein-protein interactions likely exhibit specific adaptations allowing rotational flexibility and ion transfer at subzero temperatures, though detailed structural evidence of these adaptations in P. ingrahamii specifically requires further investigation.

What expression systems are optimal for producing recombinant P. ingrahamii atpB protein?

E. coli expression systems have been successfully employed for recombinant production of P. ingrahamii atpB protein . For optimal expression, the gene sequence should be codon-optimized for E. coli, and expression vectors containing strong promoters (such as T7) with N-terminal His-tag fusion constructs have proven effective . When expressing psychrophilic proteins in mesophilic hosts, lower induction temperatures (15-20°C) are recommended to enhance proper folding. For membrane proteins like atpB, specialized E. coli strains designed for membrane protein expression (such as C41(DE3), C43(DE3), or Lemo21(DE3)) can improve yields. Post-expression purification typically employs immobilized metal affinity chromatography (IMAC) utilizing the His-tag, followed by size exclusion chromatography to achieve >90% purity as determined by SDS-PAGE .

What reconstitution methods should be used for functional studies of P. ingrahamii atpB?

For functional studies, P. ingrahamii atpB must be properly reconstituted after purification. The recommended protocol involves reconstituting the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For membrane protein functional assays, reconstitution into proteoliposomes provides a native-like environment. This can be achieved by mixing purified protein with phospholipids (typically E. coli polar lipids or synthetic phospholipids with higher proportions of unsaturated fatty acids to maintain fluidity at low temperatures) in detergent, followed by detergent removal via dialysis or adsorption to Bio-Beads. For ATP synthase activity assays, the reconstituted proteoliposomes should be energized with an artificial proton gradient, and ATP synthesis can be monitored using luciferase-based ATP detection methods. All functional assays should be conducted at temperature ranges relevant to P. ingrahamii's native environment (−12°C to 10°C) to accurately assess cold-adapted functionality.

What analytical techniques are most effective for studying the structure-function relationship of P. ingrahamii atpB?

To comprehensively investigate structure-function relationships in P. ingrahamii atpB, multiple complementary analytical approaches are recommended:

These techniques, used in combination, can reveal how specific structural adaptations in P. ingrahamii atpB contribute to its function at extremely low temperatures and how these adaptations differ from mesophilic homologs .

How does P. ingrahamii atpB compare to ATP synthase components from alkaliphiles and thermophiles?

The ATP synthase a-subunit (atpB) from P. ingrahamii exhibits distinct adaptations compared to those from alkaliphiles and thermophiles, reflecting their contrasting environmental challenges:

While alkaliphilic ATP synthases must overcome bioenergetic challenges related to adverse pH gradients that lower protonmotive force, psychrophilic ATP synthases like P. ingrahamii's must maintain catalytic efficiency despite reduced molecular kinetics at low temperatures . Unlike some extremophiles that switch to Na+-coupled ATP synthesis under challenging conditions, P. ingrahamii likely maintains H+-coupled ATP synthesis similar to alkaliphiles, though through different adaptive mechanisms .

What can comparative genomics reveal about psychrophilic adaptations in P. ingrahamii ATP synthase?

Comparative genomic analysis of P. ingrahamii reveals several insights about its ATP synthase adaptations. The genome contains at least six distinct protein clusters (compared to four or five in many other bacteria), with one cluster potentially containing cold-specific proteins . Protein composition analysis shows strong opposition between asparagine and oxygen-sensitive amino acids (methionine, arginine, cysteine, histidine), which may reflect adaptations for function at low temperatures and high oxygen solubility conditions . The genome encodes numerous transport systems (11 three-subunit TRAP systems) that likely support nutrient acquisition in cold environments, indirectly supporting energy production for ATP synthesis . Additionally, P. ingrahamii possesses genes for chaperones and stress proteins that may facilitate proper folding of ATP synthase components at low temperatures . Genomic analysis also indicates potential connections between the numerous cyclic GDP regulators and extracellular polysaccharide production that may create microenvironments supporting membrane protein function in extreme cold .

Is there evidence for convergent evolution in ATP synthase adaptations across different extremophiles?

Comparative analysis suggests both convergent and divergent evolutionary paths in ATP synthase adaptations across extremophiles. While alkaliphiles and psychrophiles both face bioenergetic challenges, they have evolved different solutions. Alkaliphilic ATP synthases employ specialized adaptations for proton capture and utilization under high pH conditions but cannot resolve their energetic problems simply by increasing c-subunit numbers in the rotor ring . Psychrophiles like P. ingrahamii appear to have evolved distinct protein compositions with potentially reduced hydrophobicity in membrane regions to maintain fluidity and function at extremely low temperatures .

How can P. ingrahamii atpB be utilized in cold-active enzyme biotechnology research?

P. ingrahamii atpB represents a valuable model for cold-active enzyme biotechnology with several promising research applications:

• Cold-adaptive biocatalyst design: Structural studies of P. ingrahamii atpB can reveal design principles for engineering cold-active properties into mesophilic enzymes for industrial applications requiring low-temperature catalysis.

• Cryopreservation technology: Understanding how this transmembrane protein maintains functionality at -12°C can inform development of improved cryoprotectants and cryopreservation methods for biological samples and tissues.

• Energetic efficiency studies: P. ingrahamii ATP synthase may demonstrate unique energetic efficiency at low temperatures, potentially informing the design of energy-efficient nanomotors or biomimetic devices.

• Structure-based drug design: As an evolutionarily distinct version of a highly conserved enzyme complex, comparative analysis of P. ingrahamii atpB could reveal unique binding pockets for targeted antimicrobial development against pathogens while sparing human ATP synthases.

• Cold-adaptation mechanisms: Site-directed mutagenesis studies can identify specific residues crucial for cold adaptation, expanding fundamental knowledge of protein structure-function relationships at temperature extremes .

These applications require careful experimental design employing the recombinant protein production methods described in section 3.1 and appropriate functional assays conducted at psychrophilic temperatures.

What methodological challenges exist in studying P. ingrahamii atpB function at subzero temperatures?

Investigating P. ingrahamii atpB function at subzero temperatures presents several methodological challenges that researchers must address:

• Maintaining liquid-phase reactions: Experiments must prevent freezing of reaction buffers, typically requiring addition of cryoprotectants (glycerol, trehalose, or specialized antifreeze compounds) that may themselves impact protein function.

• Instrument limitations: Standard laboratory equipment often lacks temperature control capacity below 4°C, requiring specialized cooling systems capable of stable temperature maintenance at -12°C.

• Reference standard issues: Conventional enzyme activity standards established at mesophilic temperatures may not apply at subzero conditions, necessitating development of psychrophile-specific enzyme kinetics models.

• Altered solvent properties: Buffer pH, ion solubility, and oxygen content change significantly at subzero temperatures, requiring careful compensation and calibration of experimental conditions.

• Membrane phase transitions: For membrane protein studies, lipid compositions must be carefully selected to prevent phase transitions that would compromise the native-like environment of atpB.

• Protein stability assessment: Distinguishing between cold-induced conformational changes that represent functional adaptations versus those indicating denaturation requires specialized analytical approaches combining activity assays with structural monitoring.

These challenges can be addressed through careful experimental design, including the use of antifreeze proteins from psychrophiles as buffer additives, development of specialized low-temperature bioreactors, and adapting analytical techniques like cryo-electron microscopy that function effectively under extreme cold conditions.

How might studying P. ingrahamii atpB contribute to understanding bioenergetic adaptations to climate change?

Research on P. ingrahamii atpB provides valuable insights into bioenergetic adaptations relevant to climate change scenarios:

• Thermal range flexibility: Understanding how this ATP synthase maintains function across temperature ranges can inform predictions about microbial community adaptations to fluctuating temperatures in polar regions experiencing climate change.

• Energy efficiency mechanisms: P. ingrahamii has evolved highly efficient energy production systems to survive in cold environments where metabolic rates are naturally reduced. These efficiency mechanisms could inform bioenergetic adaptations required in ecosystems experiencing resource limitations due to climate change.

• Stress response integration: The relationship between ATP production and other cellular stress responses in P. ingrahamii may reveal how energy generation systems adapt to multiple simultaneous stressors (temperature, salinity changes, pH shifts) expected under climate change scenarios.

• Evolutionary rate assessment: Comparative genomics focusing on atpB can help estimate rates of adaptive evolution in response to temperature changes, providing insights into potential adaptation timeframes for various organisms facing climate shifts.

• Ecosystem function predictions: As a key component of energy metabolism in a dominant polar marine species, understanding P. ingrahamii ATP synthase adaptation informs predictions about ecosystem-level energetic responses to warming in polar regions .

This research area requires integrating biophysical studies of the isolated protein with ecosystem-level analyses and climate models to translate molecular insights into ecological predictions.

What unknown aspects of P. ingrahamii atpB structure and function represent priority research questions?

Several critical knowledge gaps regarding P. ingrahamii atpB structure and function remain as priority research questions:

• High-resolution structure: No crystal or cryo-EM structure of P. ingrahamii atpB currently exists, limiting understanding of its cold-adaptive structural features. Determining this structure would reveal specific psychrophilic adaptations in transmembrane regions and ion channels.

• Proton binding kinetics: How proton affinity and release kinetics differ from mesophilic homologs at various temperatures remains unexplored but is crucial for understanding cold adaptation of the proton translocation mechanism.

• Protein-lipid interactions: The specific lipid interactions that maintain atpB function in cold, rigid membranes represent an important research frontier, particularly regarding potential adaptations at the protein-lipid interface.

• Evolutionary origins: Whether P. ingrahamii atpB evolved from a mesophilic ancestor or has ancient psychrophilic origins remains undetermined but would provide important evolutionary context for extremophile adaptation.

• Unique motifs: The functional significance of psychrophile-specific sequence motifs in atpB that may be revealed through comprehensive comparative genomics represents a key research question .

• Cryoprotective mechanisms: Whether P. ingrahamii atpB possesses intrinsic cryoprotective properties or depends entirely on extrinsic cellular mechanisms (osmolytes, extracellular polysaccharides) for function at -12°C remains to be determined.

Addressing these questions will require integrated approaches combining structural biology, comparative genomics, and functional biochemistry at psychrophilic temperatures.

How can systems biology approaches enhance our understanding of P. ingrahamii ATP synthase in the context of cold adaptation?

Systems biology approaches offer powerful frameworks for understanding P. ingrahamii ATP synthase within the broader context of cellular cold adaptation:

These systems approaches require collaborative efforts combining expertise in bioinformatics, biochemistry, and computational biology, with special attention to generating data under relevant psychrophilic conditions.

What hypotheses exist regarding the potential specialized chaperones or assembly factors for P. ingrahamii ATP synthase?

Several hypotheses exist regarding specialized chaperones and assembly factors for P. ingrahamii ATP synthase:

• Cold-specific assembly factors: P. ingrahamii may possess unique ATP synthase assembly factors not found in mesophiles that facilitate complex formation at low temperatures where protein-protein interactions are typically weakened.

• Modified chaperone specificity: Standard chaperones (GroEL/GroES, DnaK) may have evolved specialized substrate recognition patterns in P. ingrahamii to preferentially interact with ATP synthase components requiring assistance for cold-temperature folding.

• Membrane-associated assembly pathway: The genome analysis revealing potential cold-specific proteins suggests P. ingrahamii may employ a modified membrane-associated assembly pathway for ATP synthase with specialized factors to ensure proper insertion of atpB into cold, rigid membranes.

• Co-translational assembly enhancement: P. ingrahamii may have evolved enhanced co-translational assembly mechanisms where nascent ATP synthase components are assembled during translation to minimize exposure of hydrophobic surfaces in the cold aqueous environment.

• Lipid-associated chaperones: Specialized lipid-associated chaperones may exist that specifically facilitate membrane protein folding in psychrophilic conditions where membrane fluidity is reduced.

Testing these hypotheses requires comparative genomic identification of candidate chaperones, followed by biochemical validation of their interactions with ATP synthase components under psychrophilic conditions. Knockout studies in P. ingrahamii would be particularly informative, though challenging due to limited genetic tools for this organism.

What are the broader implications of P. ingrahamii atpB research for understanding extremophile bioenergetics?

Research on P. ingrahamii atpB provides critical insights into extremophile bioenergetics with broad implications. This work challenges conventional understanding of protein function at temperature extremes, demonstrating that essential energy-generating machinery can maintain functionality even at -12°C . The unique adaptations in P. ingrahamii ATP synthase expand our understanding of the limits of biological energy transduction and demonstrate nature's remarkable capacity for specialized adaptation to seemingly uninhabitable environments. By revealing mechanisms that maintain proton-coupled rotary catalysis under extreme conditions, this research establishes new paradigms for bioenergetic adaptation that complement studies of alkaliphiles and thermophiles . Together, these extremophile studies create a comprehensive framework for understanding how life's fundamental energy-generating machinery can be modified to function across Earth's full range of habitable conditions, with implications extending to astrobiology and the search for life in extreme environments beyond Earth.

How might synthetic biology applications benefit from insights gained from P. ingrahamii atpB research?

Synthetic biology applications can derive substantial benefits from P. ingrahamii atpB research through several pathways:

• Cold-active biocatalyst engineering: Structural principles derived from P. ingrahamii atpB can inform rational design of cold-active enzymes for industrial biocatalysis applications requiring low-temperature processing (food processing, detergents, bioremediation in cold climates).

• Minimal cell design: Understanding the essential adaptations that enable bioenergetic function at temperature extremes can inform the design of minimal synthetic cells with expanded environmental tolerance ranges.

• Membrane protein engineering: Insights into how membrane proteins maintain functionality in rigid lipid environments can guide development of robust synthetic membrane protein systems for biosensors and bioenergy applications.

• Nanomotor design: The P. ingrahamii ATP synthase represents a naturally optimized nanomotor functioning at low temperatures, potentially inspiring biomimetic nanomachines for low-temperature applications.

• Metabolic pathway optimization: Understanding cold-adapted energy production can inform metabolic engineering approaches to create microorganisms with expanded temperature ranges for biotechnology applications.

These applications require translating fundamental structural and mechanistic insights from P. ingrahamii research into practical design principles that can be implemented in synthetic biological systems, representing an important frontier at the intersection of extremophile biology and synthetic biology .

What collaborative research approaches would most effectively advance our understanding of P. ingrahamii atpB structure, function, and evolution?

Advancing P. ingrahamii atpB research most effectively requires multidisciplinary collaborative approaches integrating:

• Structural biology and biophysics: Employing cryo-electron microscopy, X-ray crystallography, and molecular dynamics simulations to resolve high-resolution structures and dynamic properties at psychrophilic temperatures.

• Comparative genomics and evolutionary biology: Analyzing ATP synthase sequences across temperature gradients to identify convergent and divergent evolutionary adaptations to cold environments.

• Biochemistry and enzymology: Developing specialized assay systems for measuring ATP synthase activity at subzero temperatures with appropriate controls and standards.

• Synthetic biology and protein engineering: Testing hypotheses about cold-adaptive features through rational design and directed evolution approaches.

• Systems biology and bioinformatics: Integrating various data types to understand ATP synthase function within the broader context of cellular cold adaptation.