Recombinant Psychromonas ingrahamii Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Functional Domains

YidC proteins share a conserved 5-transmembrane (TM) core that forms a hydrophilic cavity accessible from the cytoplasm and lipid bilayer. In P. ingrahamii, a psychrophile thriving in subzero environments, YidC likely exhibits structural adaptations to maintain membrane fluidity and protein folding efficiency at low temperatures .

Production and Purification

Recombinant P. ingrahamii YidC is typically expressed in E. coli and purified via affinity chromatography (e.g., His-tag) .

Functional Role in Membrane Protein Biogenesis

YidC operates in two pathways:

  1. YidC-Only Pathway: Inserts small substrates (e.g., MscL, TssL) independently, recognizing short hydrophilic N-tails or TM segments .

  2. YidC-Sec Pathway: Collaborates with the Sec translocon to insert larger substrates (e.g., ATP synthase subunits, cytochrome oxidase) .

Mechanistic Insights:

  • Substrate Recruitment: The C1 loop interacts with SRP/FtsY and ribosomes, while the C2 loop and C-terminal region bind nascent chains .

  • Membrane Thinning: YidC reduces lipid bilayer thickness (~7–10 Å), facilitating hydrophobic TM segment insertion .

  • Cold Adaptation: P. ingrahamii YidC may exhibit reduced hydrophobicity in TM regions to prevent freezing-induced membrane damage .

B. Physiological Relevance in P. ingrahamii

AspectDetailSource
Cold StressGenome-wide analysis reveals enriched chaperones to manage low-temperature folding
Membrane ProteinsLower hydrophobicity in integral membrane proteins (IIMPs) compared to mesophiles
OsmolytesBetaine choline and extracellular polysaccharides mitigate osmotic stress during ice formation

Applications in Biotechnology

  1. Bioremediation: Engineered YidC variants may enhance membrane protein stability in extremophiles for biofuel production.

  2. Structural Biology: Recombinant YidC serves as a model for studying insertase mechanics and membrane protein folding.

  3. Therapeutic Targets: Inhibitors of YidC homologs (e.g., mitochondrial Oxa1) could disrupt pathogen membrane biogenesis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; Ping_3611; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-566
Protein Length
full length protein
Species
Psychromonas ingrahamii (strain 37)
Target Names
yidC
Target Protein Sequence
MESQRNLLLLALLFVSFLLYTAWVEEKTPQVAPQVQTEQVDSSVPASVASSANSANLSDG VPNSPQQSSTDATSTELPASQSVTIANDELRLTISLVGGDIIKADLLQHDATLDSDTPYR LLDSGNGFTYIAQSGLIGQGPDANKNGRPLYDTTDTESVLADGQAEVSTMLHFVDADGNI FIKTFTLKRGEYVTNVAYQIENKTDSPLNVQLYAQLRETLSDDSGSMVMPVYRGGAFSTT ETRYEKYSFSDMQDGPLQKTTEGGWVAMLQHYFVSAWIPSPTDQNVLYSNIIQDKEAAIG FKAPSKTIAPQSVAELETNLWVGPKIQEEMALVAKNLDLTVDYGWLWFIAQPLFKLLLFF QGIVGNWGVAIILITFTVKGALYPLTKAQYTSMAKMRLLQPKIKELREQFGEDRQKVSKA MMELYKKEKVNPLGGCFPILLQMPIFIALYWSLMESVELRHAPFMLWIQDLSVQDPYYIL PILMGVSMFFIQKMSPTTVQDPMQQKVMQFMPVIFTFFFLWFPAGLVLYWLMSNVVTLIQ QTLIYRSFEKKGLHQKEKEPVVLTKK
Uniprot No.

Target Background

Function
This protein is essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It plays a role in integrating membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. It also assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Psychromonas ingrahamii and why is it significant for YidC research?

Psychromonas ingrahamii is a psychrophilic bacterium isolated from sea ice off Point Barrow, Alaska. This large rod-shaped bacterium belongs to the gamma-Proteobacteria family and represents one of the most extreme cold-adapted microorganisms known to science. P. ingrahamii is remarkable for its ability to grow at temperatures as low as -12°C with a generation time of 240 hours, which is the lowest growth temperature of any organism authenticated by a verified growth curve . This extreme adaptation makes it an invaluable model organism for studying how membrane proteins like YidC function in cold environments. The unique adaptations of P. ingrahamii's cellular machinery, including its membrane protein insertion systems, provide critical insights into biochemical processes that remain functional at temperatures where most biological reactions typically cease.

How does the structure of YidC in P. ingrahamii differ from mesophilic bacterial homologs?

The YidC membrane protein insertase in P. ingrahamii exhibits structural adaptations that allow it to function at subfreezing temperatures. While the core structural elements of YidC remain conserved across bacterial species (including the groove-like structure at the protein-lipid interface that facilitates membrane protein insertion), P. ingrahamii YidC contains specific modifications. These adaptations likely include increased flexibility in certain regions, altered hydrophobic interactions, and modifications to the amphiphilic surfaces that interact with the cold-adapted lipid bilayer .

The periplasmic domains, particularly the P1 domain, show significant variations compared to mesophilic homologs that may contribute to proper localization and function at extremely low temperatures . These structural differences represent evolutionary adaptations that allow the protein insertion machinery to maintain sufficient flexibility and catalytic activity despite the reduced molecular motion and increased membrane rigidity characteristic of psychrophilic environments.

What are the optimal conditions for expressing recombinant P. ingrahamii YidC in mesophilic expression systems?

When expressing recombinant P. ingrahamii YidC in mesophilic systems like E. coli, several methodological considerations are critical:

  • Expression System Selection: Arctic Express DE3 (Agilent Technologies) cells are particularly effective as they overexpress psychrophilic chaperones that assist in proper folding of cold-adapted proteins .

  • Growth Medium Optimization: Replace standard LB with defined media like M9ZB for improved expression yield. Grow cells at 37°C until OD600 reaches approximately 2.5 .

  • Induction Parameters: Induce expression with 1M IPTG at low temperatures (10-16°C) for 20-24 hours to allow proper folding while reducing inclusion body formation .

  • Fusion Tag Strategy: Generate MBP-YidC fusion constructs to enhance solubility. As observed with other P. ingrahamii proteins, removal of the fusion tag may lead to protein precipitation, so retention of the tag during purification and subsequent experiments may be necessary .

  • Lysis Conditions: Use a buffer containing 20 mM Tris-HCl pH 7.50, 10% glycerol, 50 mM NaCl, and 10 mM 2-Mercaptoethanol supplemented with DNase I and protease inhibitors (without EDTA) .

This approach mirrors successful strategies employed for other psychrophilic proteins from P. ingrahamii and accommodates the unique folding requirements of cold-adapted membrane proteins.

What are the recommended protocols for purifying functional recombinant YidC from P. ingrahamii?

Purification of recombinant P. ingrahamii YidC requires careful handling to maintain protein stability and functionality:

Purification StepConditionsCritical Parameters
Cell LysisFrench press homogenizer: 1× at 500 psi, 3× at 10,000 psiComplete lysis while minimizing heat generation
Affinity ChromatographyAmylose resin incubation at 4°C for 3 hoursGentle binding to preserve protein structure
Chaperone Removal20 column volumes wash with chaperone removal buffer containing 50 mM KCl and 5 mM ATPEssential for removing co-purifying chaperones
Elution10 mM maltose at 4°C for 3 hoursSlow elution improves yield and quality
Size ExclusionHiLoad 16/60 Superdex 200 preparatory gradeSeparates functional protein from aggregates
Storage-80°C in buffer with 10% glycerolPrevents freeze-thaw damage

For membrane proteins like YidC, additional considerations include maintaining a suitable detergent concentration throughout purification to prevent aggregation while retaining the native-like environment necessary for function. This protocol is adapted from successful purification strategies used for other P. ingrahamii proteins and should be optimized specifically for YidC's requirements.

How can researchers effectively assay YidC insertase activity at sub-zero temperatures?

Assaying YidC insertase activity at sub-zero temperatures presents unique challenges that require specialized approaches:

  • Cryo-buffer System: Develop a buffer system containing 30% glycerol or similar cryoprotectants that prevent freezing while maintaining an aqueous environment conducive to protein function, similar to the approach used for studying P. ingrahamii DNA polymerases at -19°C .

  • Extended Reaction Timeframes: Allow substantially longer incubation times (hours to days) to account for dramatically reduced reaction kinetics at sub-zero temperatures. For example, P. ingrahamii DNA polymerase required 7+ hours to complete even short extensions at -19°C .

  • Substrate Preparation: Use fluorescently labeled substrate proteins to enable direct visualization of insertion events through gel-based or spectroscopic methods.

  • Activity Measurement: Implement a protease protection assay where successful membrane insertion renders specific domains of the substrate protein resistant to proteolytic digestion. Compare digestion patterns between reactions performed at various temperatures.

  • Control Experiments: Include parallel assays with mesophilic YidC homologs as negative controls that should show minimal or no activity at sub-zero temperatures.

This methodology leverages established approaches for measuring the activity of other cold-adapted enzymes from P. ingrahamii and adapts them specifically for membrane protein insertion assays.

What role does the P1 domain play in YidC function and localization in P. ingrahamii?

The P1 periplasmic domain appears to play a crucial role in YidC localization and potentially in its function:

Understanding this domain's role in psychrophiles provides insights into cold-adaptation mechanisms for membrane protein biogenesis machinery.

How do the kinetics of YidC-mediated protein insertion differ between psychrophilic and mesophilic systems?

The kinetics of YidC-mediated protein insertion show distinct temperature-dependent patterns between psychrophilic and mesophilic systems:

  • Rate-Temperature Relationship: In psychrophilic YidC from P. ingrahamii, insertion activity likely exhibits a less pronounced decline at low temperatures compared to mesophilic homologs, similar to the observed behavior of P. ingrahamii DNA polymerases that retain activity at temperatures as low as -19°C .

  • Activation Energy Considerations: Psychrophilic YidC likely displays a lower activation energy for the insertion process, allowing catalysis to proceed despite reduced thermal energy. This adaptation typically involves modifications to the catalytic site that reduce energy barriers.

  • Substrate Specificity Changes: The substrate recognition profile may differ between psychrophilic and mesophilic YidC variants, with the psychrophilic version potentially exhibiting broader specificity at low temperatures.

  • Temperature Range Analysis: While mesophilic YidC homologs typically show optimal activity around 37°C with sharp declines below 20°C, P. ingrahamii YidC likely maintains significant activity across a broader lower temperature range (potentially from -12°C to 20°C).

  • Cold-Induced Conformational Changes: Unlike mesophilic homologs that may undergo detrimental conformational changes at low temperatures, psychrophilic YidC likely employs structural adaptations that preserve essential dynamics even in cold conditions.

These differences reflect evolutionary adaptations that allow P. ingrahamii to maintain functional membrane protein biogenesis machinery at temperatures where mesophilic systems would cease to function.

What molecular adaptations in P. ingrahamii YidC facilitate function at sub-freezing temperatures?

P. ingrahamii YidC exhibits several key molecular adaptations that enable function at sub-freezing temperatures:

  • Increased Structural Flexibility: Psychrophilic proteins typically feature fewer rigid structural elements like proline residues and disulfide bonds, instead favoring glycine residues that provide local flexibility. This allows sufficient conformational mobility even when thermal energy is limited at sub-zero temperatures.

  • Reduced Hydrophobic Core Packing: The hydrophobic regions likely display less compact packing compared to mesophilic homologs, reducing the energy required for conformational changes necessary during the insertion process.

  • Surface Charge Distribution: An increased proportion of negatively charged residues on protein surfaces helps maintain solvation in cold environments where water molecules have reduced mobility.

  • Active Site Modifications: The substrate-binding groove likely has optimized dimensions and physiochemical properties to facilitate interaction with membrane proteins at low temperatures.

  • Interaction with Cold-Adapted Lipids: YidC from P. ingrahamii has likely evolved to function optimally within the unique lipid composition found in psychrophilic membranes, which typically feature increased proportions of unsaturated fatty acids to maintain fluidity at low temperatures.

These adaptations collectively represent a fine-tuned evolutionary response that balances protein stability against the flexibility required for catalytic function in extreme cold environments.

What are common challenges in genetic manipulation of P. ingrahamii YidC and how can they be addressed?

Researchers working with P. ingrahamii YidC often encounter several technical challenges that require specific solutions:

  • High GC Content Issues: The YidC gene regions, particularly the P1 domain, may contain high GC content that complicates PCR amplification and cloning. This can be addressed by:

    • Using specialized PCR enhancers or DMSO to reduce secondary structure formation

    • Implementing touchdown PCR protocols with careful temperature gradient optimization

    • Employing specialized polymerases designed for high-GC templates

  • Primer Design Complications: Designing primers for domain deletion or site-directed mutagenesis can be challenging due to secondary structure formation and nonspecific binding. Solutions include:

    • Increasing primer length (35-45 nucleotides) to enhance specificity

    • Careful analysis of potential secondary structures

    • Using optimized annealing temperatures (e.g., 67°C has been successful in some cases)

  • Transformation Efficiency: P. ingrahamii-derived constructs may transform with lower efficiency in standard laboratory strains. This can be improved by:

    • Using electroporation rather than chemical transformation

    • Employing specialized competent cells designed for difficult constructs

    • Reducing ligation product size through appropriate restriction enzyme selection

  • Sequence Verification Challenges: Confirming successful modifications can be complicated by nonspecific recombination events. Researchers should:

    • Perform comprehensive screening with both interior and exterior primer pairs

    • Verify constructs through complete sequencing rather than relying solely on restriction digestion patterns

    • Be alert to potential insertion of additional nucleotide fragments, as observed in constructs #3 and #15 in previous studies

These methodological refinements significantly improve success rates when working with this challenging psychrophilic protein.

How can researchers distinguish between temperature effects and intrinsic properties when studying P. ingrahamii YidC?

Differentiating temperature-dependent effects from intrinsic properties of P. ingrahamii YidC requires carefully designed experimental approaches:

  • Comparative Analysis Framework: Design experiments that systematically compare:

    • P. ingrahamii YidC against mesophilic homologs (e.g., from E. coli)

    • The same YidC variant across a temperature gradient

    • Wild-type YidC versus site-directed mutants targeting putative cold-adaptation features

  • Control Protein Selection: Include well-characterized proteins with known temperature responses as internal controls:

    • Cold-shock proteins that naturally function at low temperatures

    • Heat-sensitive proteins that lose function in cold conditions

    • Engineered temperature-insensitive variants as reference points

  • Structural Analysis Under Various Conditions: Employ techniques like:

    • Circular dichroism spectroscopy at different temperatures to monitor secondary structure changes

    • Hydrogen-deuterium exchange mass spectrometry to assess protein dynamics

    • Temperature-resolved NMR to track conformational changes

  • Substrate Specificity Testing: Analyze:

    • Whether substrate preference changes with temperature

    • If rate-limiting steps in the catalytic mechanism shift across temperature ranges

    • How substrate binding affinity correlates with temperature

  • Genetic Complementation Studies: Test whether:

    • P. ingrahamii YidC can complement YidC-deficient mesophilic strains at different temperatures

    • Mesophilic YidC can restore function in P. ingrahamii at low temperatures

    • Chimeric constructs with domains from psychrophilic and mesophilic sources reveal temperature-specific functional elements

This systematic approach allows researchers to separate intrinsic molecular properties from temperature-dependent phenomena when characterizing this remarkable cold-adapted protein.

What are promising applications of P. ingrahamii YidC in low-temperature biotechnology?

The unique properties of P. ingrahamii YidC open several promising research avenues in low-temperature biotechnology:

  • Membrane Protein Production Systems: Developing expression systems incorporating psychrophilic YidC could enhance the production of challenging membrane proteins at low temperatures, potentially improving folding and reducing aggregation for proteins that are difficult to express in conventional systems.

  • Biomedical Applications: Engineered membrane insertion systems based on psychrophilic YidC could facilitate low-temperature preservation of cellular therapies and tissues by helping maintain membrane integrity during cryopreservation processes.

  • Biocatalysis at Low Temperatures: Creating chimeric membrane-associated enzyme complexes with P. ingrahamii YidC components could enable biocatalytic reactions in cold environments that would normally be kinetically unfavorable.

  • Synthetic Biology Tools: Psychrophilic YidC variants could serve as components for synthetic biology applications requiring protein expression and membrane insertion in cold environments or during low-temperature bioprocessing steps.

  • Structural Biology Advances: The ability to study membrane protein insertion at reduced temperatures using psychrophilic YidC could provide unique opportunities to capture transitional states in the insertion process that occur too rapidly for structural characterization at higher temperatures.

These applications leverage the fundamental understanding of cold adaptation in this essential membrane protein machinery to address challenging problems in biotechnology and basic science.

How might comparative genomics of diverse psychrophiles inform our understanding of YidC cold adaptation?

Comparative genomics approaches provide powerful frameworks for understanding YidC cold adaptation mechanisms:

  • Evolutionary Trajectory Analysis: By comparing YidC sequences across psychrophilic, mesophilic, and thermophilic organisms, researchers can identify convergent evolutionary patterns specifically associated with cold adaptation rather than phylogenetic relationships.

  • Identification of Cold-Responsive Elements: Genome-wide analysis of regulatory elements controlling YidC expression across temperature ranges can reveal how psychrophiles modulate membrane protein insertion machinery in response to temperature fluctuations.

  • Functional Domain Conservation: Examination of domain conservation patterns between YidC homologs from diverse psychrophiles (like Psychrobacter arcticus and Psychromonas ingrahamii) can identify critical regions universally required for cold functionality versus species-specific adaptations .

  • Coevolution with Partner Proteins: Analysis of coevolutionary patterns between YidC and its interaction partners across psychrophiles can reveal coordinated adaptations in the broader membrane protein insertion machinery.

  • Integration with Experimental Data: Combining genomic analysis with functional data from mutant studies (similar to those performed with csdA and rhlB cold-adaptation genes) can establish causal relationships between sequence features and cold adaptation mechanisms.

This multilayered comparative approach provides a comprehensive framework for understanding the molecular basis of YidC cold adaptation and identifying key principles that could be applied to protein engineering and synthetic biology applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.