Recombinant Psychromonas ingrahamii Na (+)-translocating NADH-quinone reductase subunit E

What is Psychromonas ingrahamii Na(+)-translocating NADH-quinone reductase subunit E and what organism does it originate from?

Psychromonas ingrahamii Na(+)-translocating NADH-quinone reductase subunit E (Na(+)-NQR subunit E) is a component of the Na(+)-NQR complex, which functions as an important membrane-bound electron transport complex involved in energy conservation. The protein originates from Psychromonas ingrahamii strain 37, an extremely psychrophilic bacterium capable of growth at temperatures as low as -12°C, with optimal exponential growth occurring at 5°C . This gram-negative marine bacterium was first isolated from sea ice cores collected from the Northeast Siberian coastal regions . The protein itself is encoded by the nqrE gene (Ping_0750) in the P. ingrahamii genome and consists of 202 amino acids in its full-length form .

The Na(+)-NQR complex plays a critical role in bioenergetics by coupling electron flow with the electrogenic translocation of Na+ ions across the cell membrane, thereby contributing to the generation of a transmembrane electrochemical gradient that can be utilized for ATP synthesis and other cellular processes .

What is the amino acid sequence and basic structural information for Na(+)-NQR subunit E from P. ingrahamii?

The full amino acid sequence of P. ingrahamii Na(+)-NQR subunit E consists of 202 amino acids as follows:

MEHYISIFVRSIFMENMALAFFLGMCTFLAVSKKVKTSMGLGVAVIVVLGISVPVNQIIY
FNLLAPGALAWAGFPAADLSFLGFITFIGVIAALVQILEMVLDKYFPALYQALGIYLPLI
TVNCAILGGVLFMVQREYNLMESLVYGVGSGVGWMLAIVILLAGIREKMKYSDVPAGLRGL
GITFTTAGLMAIAFMSFSGIQL

The protein appears to have hydrophobic regions consistent with a membrane-embedded protein, which aligns with its known function as part of a membrane-bound electron transport complex. Structural analysis suggests it contains transmembrane domains that participate in forming the ion translocation pathway of the Na(+)-NQR complex. The protein's structure likely contributes to its function in generating and maintaining Na+ gradients across the bacterial membrane, similar to other Na(+)-translocating NADH:quinone oxidoreductases that have been characterized .

What are the optimal storage and handling conditions for recombinant P. ingrahamii Na(+)-NQR subunit E?

For optimal stability and activity maintenance, recombinant P. ingrahamii Na(+)-NQR subunit E should be stored using the following guidelines:

• Primary storage: -20°C in a Tris-based buffer containing 50% glycerol, which has been optimized for this specific protein

• Extended storage: -20°C or -80°C for long-term preservation

• Working solutions: Store aliquots at 4°C for up to one week

• Avoid repeated freeze-thaw cycles as they may lead to protein denaturation and loss of activity

The protein is typically supplied in a quantity of 50 μg, though other quantities may be available depending on experimental needs . When designing experiments involving this protein, researchers should consider its psychrophilic origin and potentially test functional assays at lower temperatures that better reflect the native environment of P. ingrahamii.

How do expression systems for recombinant proteins from psychrophilic organisms differ from standard protocols?

Expressing recombinant proteins from psychrophilic organisms like P. ingrahamii requires specialized considerations that differ from standard protocols used for mesophilic proteins:

Temperature considerations:

• Lower expression temperatures (10-15°C) are often required to maintain proper folding

• Longer induction times may be necessary to achieve adequate protein yields at reduced temperatures

• Cold-shock promoters or cold-inducible systems might provide better expression results

Expression host selection:

• Cold-adapted expression hosts or psychrophilic expression systems may improve proper folding

• For instance, studies with other psychrophilic proteins, such as the nuclease PinNuc from P. ingrahamii, have successfully used Pichia pastoris as an expression system

Buffer optimization:

• Buffer composition may need adjustments to maintain stability at lower temperatures

• Higher salt concentrations (reflecting the marine origin of P. ingrahamii) may improve stability

• Inclusion of osmolytes that function as cryoprotectants can enhance stability

Protein purification:

• Purification steps should be performed at reduced temperatures

• Gentler elution conditions are often required to preserve activity

• Additional stabilizing agents may be needed throughout the purification process

When expressing Na(+)-NQR subunit E specifically, researchers should consider using expression systems that have been optimized for membrane proteins, as improper expression can lead to aggregation or misfolding of these hydrophobic proteins.

What experimental approaches can be used to study Na+ translocation activity of the Na(+)-NQR complex?

Several sophisticated experimental approaches can be employed to study the Na+ translocation activity of the Na(+)-NQR complex from P. ingrahamii:

Inverted membrane vesicle assays:

• Preparation of inverted membrane vesicles from bacterial cells expressing the Na(+)-NQR complex

• Measurement of 22Na+ transport into vesicles coupled with electron flow from electron donors (such as ferredoxin and titanium (III) citrate) to electron acceptors (NAD+)

• Monitoring of Na+ transport using radioactive 22Na+ as a tracer to quantify translocation efficiency

Electrophysiological measurements:

• Reconstitution of purified Na(+)-NQR complex into proteoliposomes or planar lipid bilayers

• Patch-clamp techniques to directly measure ion currents across membranes

• Assessment of electrogenic nature of transport by measuring membrane potential changes

Ion-selective electrode measurements:

• Real-time monitoring of Na+ concentration changes using Na+-selective electrodes

• Determination of stoichiometry by comparing ion translocation to electron transfer rates

Inhibitor studies:

• Use of specific inhibitors such as the Na+ ionophore ETH2120 to confirm Na+ transport specificity

• Comparison with the effects of protonophores to distinguish between Na+ and H+ transport mechanisms

Biochemical coupling assays:

• Assessment of Na+ transport coupling to NADH oxidation and quinone reduction

• Determination of the relationship between electron transfer rates and Na+ translocation efficiency

These methodologies have been successfully employed with related Na+-translocating complexes such as the Rnf complex in Acetobacterium woodii, which has structural and functional similarities to the Na(+)-NQR complex .

How can researchers determine whether the Na(+)-NQR complex from P. ingrahamii is Na+ or H+ dependent?

Determining whether the Na(+)-NQR complex from P. ingrahamii is Na+ or H+ dependent requires a systematic experimental approach:

Ion dependency assays:

• Conduct activity assays in buffers with varying Na+ concentrations (0-200 mM) to establish Na+ dependency

• Perform parallel experiments with different pH values to assess H+ dependency

• Compare activity patterns to distinguish between Na+ and H+ coupling mechanisms

Selective ionophore experiments:

• Test the effect of Na+-specific ionophores (e.g., ETH2120) on activity and ion transport

• Compare with the effects of protonophores (e.g., CCCP, DNP)

• Na+-dependent complexes will show inhibition with Na+ ionophores but not with protonophores

ATP synthesis coupling:

• Measure ATP synthesis in the presence and absence of Na+ gradient

• Analyze the effect of collapsing Na+ gradients versus H+ gradients on ATP production

Structural analysis:

• Examine the protein sequence for conserved Na+-binding motifs

• Similar to how conserved Na+-binding motifs in ATP synthase have been used to identify Na+-dependent Rnf complexes

Isotope flux measurements:

• Use 22Na+ and compare with proton flux measurements

• Quantify the stoichiometry of ion translocation per electron transferred

Molecular genetic approaches:

• Generate site-directed mutations in predicted ion-binding sites

• Analyze the effect on ion selectivity and transport efficiency

This comprehensive approach would establish whether the P. ingrahamii Na(+)-NQR complex primarily translocates Na+ or H+ ions, which is crucial for understanding its role in bioenergetics in this psychrophilic organism.

How does the Na(+)-NQR complex relate to the Rnf complex in terms of structure and function?

The Na(+)-NQR and Rnf complexes share several structural and functional similarities while maintaining distinct evolutionary trajectories:

Structural similarities:

• Both are membrane-bound electron transport complexes

• The Rnf complex shows high sequence similarity to the Na(+)-translocating NADH:quinone oxidoreductase (Na(+)-NQR)

• Both complexes contain multiple subunits that span the membrane and form ion translocation pathways

Functional parallels:

• Both complexes can couple electron transfer to Na+ translocation across membranes

• Both are involved in energy conservation mechanisms in various bacteria

• The Rnf complex, like Na(+)-NQR, can generate electrochemical gradients used for ATP synthesis

Evolutionary relationship:

• The Rnf complex was first discovered in Rhodobacter capsulatus

• Both complexes appear to have evolved to fulfill similar bioenergetic roles in different bacterial lineages

• The presence of either complex often correlates with the organism's ecological niche and metabolic strategy

Key differences:

• The Rnf complex typically couples ferredoxin:NAD+ oxidoreduction to ion translocation

• Na(+)-NQR typically couples NADH:quinone oxidoreduction to Na+ translocation

• Rnf complexes in some organisms may translocate H+ instead of Na+, showing functional versatility

Electron transfer partners:

• Na(+)-NQR: NADH → Quinone

• Rnf: Reduced ferredoxin → NAD+

This relationship between these complexes represents a fascinating example of convergent evolution in bioenergetic systems, with both fulfilling similar roles in energy conservation but through distinct molecular mechanisms.

What adaptations might the Na(+)-NQR complex from P. ingrahamii have evolved for function at extremely low temperatures?

The Na(+)-NQR complex from the extremely psychrophilic P. ingrahamii likely exhibits several cold-adaptive features that enable function at temperatures as low as -12°C:

Protein flexibility adaptations:

• Increased flexibility in protein structure to maintain catalytic activity at low temperatures

• Reduced number of proline residues in loop regions to enhance backbone flexibility

• Lower arginine/lysine ratio to reduce salt bridge formation that could restrict movement

Active site modifications:

• More accessible active sites with fewer rigid structural elements

• Potentially lower activation energy requirements for catalysis

• Modified binding pockets that remain properly shaped at low temperatures

Surface charge adaptations:

• Increased surface negative charge to prevent cold denaturation

• Modified surface hydrophobicity patterns that maintain protein-solvent interactions at low temperatures

Stability-flexibility balance:

• Fewer stabilizing interactions (hydrogen bonds, salt bridges) to prevent rigidity at low temperatures

• Strategic distribution of glycine residues to enhance flexibility in key regions

• Potential disulfide bridges positioned to maintain structural integrity while allowing flexibility

Membrane-associated adaptations:

• Modified hydrophobic transmembrane regions to maintain proper membrane insertion at low temperatures

• Adaptations to interact with cold-adapted lipid membranes that have higher unsaturated fatty acid content

This adaptation pattern is consistent with observations in other cold-adapted enzymes from psychrophilic organisms, such as the nuclease PinNuc from P. ingrahamii, which demonstrates high activity at low temperatures . Similar cold-adaptive patterns might be observed in icl genes found in the P. ingrahamii genome, which have been proposed as markers for cold adaptation .

How can the Na(+)-NQR complex from P. ingrahamii be utilized in bioenergetic research and cold-adapted biotechnology?

The Na(+)-NQR complex from P. ingrahamii offers several valuable applications in advanced research contexts:

Bioenergetic studies:

• Model system for investigating ion-coupled electron transport in extremophiles

• Platform for studying alternative energy conservation mechanisms in psychrophilic organisms

• Comparative system for understanding the evolution of chemiosmotic coupling mechanisms

Cold-adapted biotechnology:

• Development of cold-active biocatalysts for industrial processes at reduced temperatures

• Engineering of cold-adapted bioenergetic systems for biotechnological applications

• Creation of biosensors functional at low temperatures for environmental monitoring

Membrane protein research:

• Model for studying membrane protein folding and stability at low temperatures

• Investigation of protein-lipid interactions in cold environments

• Development of improved methods for membrane protein expression and purification

Synthetic biology applications:

• Integration into synthetic metabolism pathways requiring electron transport at low temperatures

• Development of minimal cell systems with cold-adapted bioenergetic modules

• Creation of hybrid energy-conserving systems combining psychrophilic and mesophilic components

Drug discovery:

• Target for developing antimicrobials against psychrophilic pathogens

• Model for studying temperature-dependent effects on membrane protein drug interactions

Environmental biotechnology:

• Development of bioremediation technologies functional in cold environments

• Creation of bioelectrochemical systems operative at low temperatures

These applications leverage the unique properties of this cold-adapted complex to address challenges in both fundamental research and applied biotechnology that conventional mesophilic systems cannot adequately address.

What methods can be employed to study the coupling between electron transfer and Na+ translocation in the Na(+)-NQR complex?

Advanced methodological approaches to investigate the coupling between electron transfer and Na+ translocation in the Na(+)-NQR complex include:

Combined spectroscopic and electrochemical approaches:

• Simultaneous measurement of electron transfer rates using spectroscopic techniques (e.g., stopped-flow spectroscopy)

• Real-time monitoring of Na+ translocation using Na+-sensitive fluorescent dyes or electrodes

• Correlation of electron transfer kinetics with ion translocation rates to establish coupling ratios

Site-directed mutagenesis strategies:

• Targeted modification of residues in proposed electron transfer pathways

• Alteration of putative ion-binding sites

• Analysis of the impact on both electron transfer and ion translocation activities

Reconstitution studies:

• Purification and reconstitution of the complex into proteoliposomes

• Controlled alteration of lipid composition to study membrane effects on coupling efficiency

• Manipulation of transmembrane ion gradients to assess their impact on electron transfer rates

Advanced microscopy techniques:

• Single-molecule studies to observe conformational changes during the coupling process

• Fluorescence resonance energy transfer (FRET) to monitor protein dynamics during electron transfer

• Cryo-electron microscopy to visualize structural states associated with different steps in the coupling mechanism

Computational approaches:

• Molecular dynamics simulations to model the coupling mechanism

• Quantum mechanical calculations to analyze electron transfer pathways

• Systems biology modeling to integrate experimental data into comprehensive mechanistic models

Temperature-dependent kinetic studies:

• Analysis of the coupling mechanism across a temperature range (from -12°C to 20°C)

• Determination of activation energies for both electron transfer and ion translocation

• Identification of temperature-dependent rate-limiting steps in the coupling process

This multi-disciplinary approach would provide comprehensive insights into how the Na(+)-NQR complex couples electron transfer to ion translocation, particularly in the context of cold adaptation in P. ingrahamii.

What are the common challenges in expressing and purifying membrane proteins from psychrophilic organisms, and how can they be addressed?

Expressing and purifying membrane proteins from psychrophilic organisms like P. ingrahamii presents several unique challenges that require specialized approaches:

Expression challenges and solutions:

Purification challenges and solutions:

Activity preservation strategies:

• Perform all purification steps at reduced temperatures (0-4°C)

• Include proper cofactors throughout the purification process

• Consider tagged constructs that allow milder elution conditions

• Use stabilizing additives specific to psychrophilic proteins

• Test reconstitution into lipid environments that mimic the native membrane composition

Quality control approaches:

• Implement rigorous homogeneity assessment using size-exclusion chromatography

• Verify proper folding through circular dichroism spectroscopy at low temperatures

• Confirm functionality through activity assays designed for low-temperature operation

• Use mass spectrometry to verify protein integrity and post-translational modifications

These specialized strategies address the unique challenges posed by psychrophilic membrane proteins while preserving their native properties and functionality.

How can researchers differentiate between Na(+)-NQR and Rnf complex activities in experimental systems?

Differentiating between Na(+)-NQR and Rnf complex activities in experimental systems requires a systematic approach targeting their distinctive characteristics:

Electron donor/acceptor specificity:

• Na(+)-NQR typically uses NADH as electron donor and quinones as electron acceptors

• Rnf complexes generally use reduced ferredoxin as electron donor and NAD+ as electron acceptor

• Comparative activity assays with different electron donors can distinguish between these complexes

Antibody-based approaches:

• Use of specific antibodies against distinctive subunits of each complex

• Western blot analysis to confirm the presence of complex-specific components

• Immunoprecipitation to isolate and verify complex composition

Genetic identification:

• PCR-based detection of genes encoding specific subunits (e.g., nqrE for Na(+)-NQR)

• Sequence analysis to distinguish between homologous subunits in each complex

• Analysis of genomic context and operon structure

Biochemical activity profiles:

• Na(+)-NQR: NADH:quinone oxidoreductase activity coupled to Na+ translocation

• Rnf: Ferredoxin:NAD+ oxidoreductase activity coupled to Na+ or H+ translocation

• Differential sensitivity to specific inhibitors can further distinguish between complexes

Proteomic analysis:

• Mass spectrometry identification of purified complex components

• Comparison with known subunit compositions of Na(+)-NQR and Rnf complexes

• Analysis of unique post-translational modifications specific to each complex

Functional differences:

• Rnf complexes in some organisms are H+-dependent rather than Na+-dependent

• The stoichiometry of ion translocation may differ between complexes

• Temperature-dependent activity profiles may show distinct patterns

By employing these approaches in combination, researchers can reliably differentiate between Na(+)-NQR and Rnf complex activities, even in systems where both complexes might be present.